The Chevrolet Malibu spans 1981–2026 with 139 recorded NHTSA recalls and a 4.5/5 ForCar reliability score. The years to approach with caution are 2004, 2009, 2005 (most owner complaints); the cleanest are 2026, 1983, 1981. It delivers up to 46 mpg combined and 5-star NHTSA safety.
How we score: NHTSA crash-test safety (40%), recall frequency across all years (25%) and the share of owner complaints involving a crash, fire or injury (35%). Based on NHTSA & EPA data — not user reviews.
Overview
The Chevrolet Malibu is one of the most popular vehicles in its class, produced from 1981 to 2026 across multiple generations.
Decode or check a Chevrolet Malibu by VIN
Enter a 17-digit VIN to decode this Chevrolet Malibu — trim, engine, plant and full specs — and instantly pull its open recalls, safety ratings and original window sticker.
How to read a Chevrolet Malibu VIN — every digit explained
Every Chevrolet Malibu carries a unique 17-character VIN stamped at the factory. Each position is a code — together they spell out where, when and how your car was built. Here's exactly what every digit means.
- WMI (1–3) — country & manufacturer. 4T1 = Toyota, built in the USA.
- VDS (4–8) — model line, body style, engine & restraint system.
- Check digit (9) — a math check that proves the VIN is genuine.
- Model year (10) — the year it was built. H = 2017.
- Plant (11) — which factory assembled this Malibu.
- Serial (12–17) — the unique sequential production number.
Model-year code (10th digit)
The 10th character is the model year. It cycles through letters and numbers, skipping I, O, Q, U, Z and 0 to avoid confusion:
Where to find your Malibu VIN
- Dashboard — driver's side, visible through the windshield from outside.
- Driver's door jamb — on the manufacturer sticker when you open the door.
- Paperwork — vehicle registration, title and insurance card.
- Engine bay & frame — stamped on the firewall or chassis on many models.
How many recalls does the Chevrolet Malibu have?
The Chevrolet Malibu has 139 recorded NHTSA recalls across 1981–2026. Pick a year below to see its recalls — then verify open recalls against your specific VIN.
2025 Chevrolet Malibu recalls 1
Back Over Prevention: Sensing System: Camera
What's wrong. General Motors, LLC (GM) is recalling certain 2023-2025 Chevrolet Malibu vehicles. The rearview camera screen may display a distorted or blank image.
Risk. A rearview image that does not display correctly reduces the driver's view behind the vehicle, increasing the risk of a crash.
Fix. Dealers will inspect, and if necessary, replace the rearview camera, free of charge. Owner notification letters were mailed May 20, 2026. Owners may contact Chevrolet customer service at 1-800-222-1020. GM's number for this recall is N262551720. Vehicle Identification Numbers (VINs) involved in this recall became searchable on NHTSA.gov on April 2, 2026.
2024 Chevrolet Malibu recalls 2
Back Over Prevention: Sensing System: Camera
What's wrong. General Motors, LLC (GM) is recalling certain 2023-2025 Chevrolet Malibu vehicles. The rearview camera screen may display a distorted or blank image.
Risk. A rearview image that does not display correctly reduces the driver's view behind the vehicle, increasing the risk of a crash.
Fix. Dealers will inspect, and if necessary, replace the rearview camera, free of charge. Owner notification letters were mailed May 20, 2026. Owners may contact Chevrolet customer service at 1-800-222-1020. GM's number for this recall is N262551720. Vehicle Identification Numbers (VINs) involved in this recall became searchable on NHTSA.gov on April 2, 2026.
Equipment:other:owners/service/other Manual
What's wrong. General Motors, LLC (GM) is recalling certain 2024 Cadillac XT4 and Chevrolet Malibu vehicles. The vehicles may have the wrong owner's manual in the glove box. As such, these vehicles fail to comply with the requirements of Federal Motor Vehicle Safety Standard number 225, "Child Restraint Anchorage Systems."
Risk. The wrong owner's manual may contain inaccurate information about vehicle functions and other safety relevant information, which could lead to improper operation of the vehicle and increase the risk of a crash or injury.
Fix. Dealers will provide owners with the correct manual, free of charge. Owner notification letters were mailed August 26, 2024. Owners may contact Cadillac's customer service at 1-800-458-8006 and Chevrolet customer service at 1-800-222-1020. GM's number for this recall is N242454040.
2023 Chevrolet Malibu recalls 2
Back Over Prevention: Sensing System: Camera
What's wrong. General Motors, LLC (GM) is recalling certain 2023-2025 Chevrolet Malibu vehicles. The rearview camera screen may display a distorted or blank image.
Risk. A rearview image that does not display correctly reduces the driver's view behind the vehicle, increasing the risk of a crash.
Fix. Dealers will inspect, and if necessary, replace the rearview camera, free of charge. Owner notification letters were mailed May 20, 2026. Owners may contact Chevrolet customer service at 1-800-222-1020. GM's number for this recall is N262551720. Vehicle Identification Numbers (VINs) involved in this recall became searchable on NHTSA.gov on April 2, 2026.
Structure:frame And Members
What's wrong. General Motors, LLC (GM) is recalling certain 2022-2023 Chevrolet Malibu vehicles. The front impact bar, a structural portion of the vehicle frame, may not be properly welded to the front frame rail.
Risk. An improperly welded front impact bar may result in the front crash sensors not performing correctly, increasing the risk of injury in a crash.
Fix. Dealers will inspect the right-hand and left-hand side of the vehicle's motor rail for an incomplete weld. If the condition is found, the vehicle will be repurchased by GM. Owner notification letters were mailed January 20, 2023. Owners may contact Chevrolet customer service at 1-800-222-1020.
2022 Chevrolet Malibu recalls 1
Structure:frame And Members
What's wrong. General Motors, LLC (GM) is recalling certain 2022-2023 Chevrolet Malibu vehicles. The front impact bar, a structural portion of the vehicle frame, may not be properly welded to the front frame rail.
Risk. An improperly welded front impact bar may result in the front crash sensors not performing correctly, increasing the risk of injury in a crash.
Fix. Dealers will inspect the right-hand and left-hand side of the vehicle's motor rail for an incomplete weld. If the condition is found, the vehicle will be repurchased by GM. Owner notification letters were mailed January 20, 2023. Owners may contact Chevrolet customer service at 1-800-222-1020.
2021 Chevrolet Malibu recalls 2
Seats
What's wrong. General Motors, LLC (GM) is recalling certain 2021 Chevrolet Malibu, 2022 Chevrolet Equinox, Blazer and Cadillac XT4 vehicles. The driver's seat cushion frame may have an improper weld in the power tilt-adjustment mechanism.
Risk. An improperly welded seat frame may not adequately restrain the driver in a crash, increasing their risk of injury.
Fix. Dealers will inspect the driver's seat and replace the cushion frame, as necessary, free of charge. Owner notification letters were mailed June 23, 2022. Owners may contact Chevrolet customer service at 1-800-222-1020 or Cadillac customer service at 1-800-458-8006. GM's number for this recall is N212356050.
Seat Belts:critical Fasteners
What's wrong. General Motors, LLC (GM) is recalling certain 2016-2021 Chevrolet Malibu and 2019-2021 Cadillac XT4 vehicles. The rear seat belt retractors may be improperly secured with loose or missing fasteners.
Risk. An improperly secured seat belt retractor may not function properly in a crash, increasing the risk of injury.
Fix. Dealers will inspect and tighten the rear seat belt retractors, as necessary, free of charge. Owner notification letters were mailed on September 17, 2021. Owners may contact Chevrolet customer service at 1-800-222-1020 and Cadillac customer service at 1-800-458-8006. GM's number for this recall is N212333380.
2020 Chevrolet Malibu recalls 1
Seat Belts:critical Fasteners
What's wrong. General Motors, LLC (GM) is recalling certain 2016-2021 Chevrolet Malibu and 2019-2021 Cadillac XT4 vehicles. The rear seat belt retractors may be improperly secured with loose or missing fasteners.
Risk. An improperly secured seat belt retractor may not function properly in a crash, increasing the risk of injury.
Fix. Dealers will inspect and tighten the rear seat belt retractors, as necessary, free of charge. Owner notification letters were mailed on September 17, 2021. Owners may contact Chevrolet customer service at 1-800-222-1020 and Cadillac customer service at 1-800-458-8006. GM's number for this recall is N212333380.
2019 Chevrolet Malibu recalls 1
Seat Belts:critical Fasteners
What's wrong. General Motors, LLC (GM) is recalling certain 2016-2021 Chevrolet Malibu and 2019-2021 Cadillac XT4 vehicles. The rear seat belt retractors may be improperly secured with loose or missing fasteners.
Risk. An improperly secured seat belt retractor may not function properly in a crash, increasing the risk of injury.
Fix. Dealers will inspect and tighten the rear seat belt retractors, as necessary, free of charge. Owner notification letters were mailed on September 17, 2021. Owners may contact Chevrolet customer service at 1-800-222-1020 and Cadillac customer service at 1-800-458-8006. GM's number for this recall is N212333380.
2018 Chevrolet Malibu recalls 6
Seat Belts:critical Fasteners
What's wrong. General Motors, LLC (GM) is recalling certain 2016-2021 Chevrolet Malibu and 2019-2021 Cadillac XT4 vehicles. The rear seat belt retractors may be improperly secured with loose or missing fasteners.
Risk. An improperly secured seat belt retractor may not function properly in a crash, increasing the risk of injury.
Fix. Dealers will inspect and tighten the rear seat belt retractors, as necessary, free of charge. Owner notification letters were mailed on September 17, 2021. Owners may contact Chevrolet customer service at 1-800-222-1020 and Cadillac customer service at 1-800-458-8006. GM's number for this recall is N212333380.
Power Train:automatic Transmission
What's wrong. General Motors LLC (GM) is recalling certain 2018-2019 Chevrolet Cruze and Buick LaCrosse, 2018-2020 Chevrolet Equinox, Chevrolet Traverse and GMC Terrain, 2018 Chevrolet Malibu, 2019-2020 Buick Encore, Buick Enclave, Cadillac XT4, Chevrolet Blazer and GMC Acadia, and 2020 Cadillac XT6 vehicles. The start/stop accumulator endcap may have missing bolts.
Risk. Missing bolts on the start-stop accumulator endcap could result in a transmission oil leak and may progress to a loss of propulsion, increasing the risk of a crash. A transmission fluid leak in the presence of an ignition source may increase the risk of fire.
Fix. GM will notify owners, and dealers will inspect the start-stop transmission accumulator and replace it if any bolts are missing, free of charge. The recall began December 15, 2020. Owners may contact GMC customer service at 1-888-988-7267, Buick Customer service at 1-866-608-8080, Chevrolet customer service at 1-800-222-1020 or Cadillac customer service at 1-800-458-8006. GM's number for this recall is N202313440.
Electrical System:software
What's wrong. General Motors LLC (GM) is recalling certain 2018 Chevrolet Malibu vehicles equipped with 1.5L turbo engines. An error in the Engine Control Module (ECM) software may result in the fuel injectors being disabled.
Risk. Disabled fuel injectors would prevent the engine from starting and may cause a stall, increasing the risk of a crash.
Fix. GM will notify owners, and dealers will reprogram the ECM software, free of charge. The recall began October 16, 2019. Owners may contact GM customer service at 1-800-630-2438. GM's number for this recall is N192221960.
Fuel System, Gasoline:delivery:fuel Pump
What's wrong. General Motors LLC (GM) is recalling certain 2015-2018 GMC Canyon, 2016-2017 Buick Envision, 2016-2018 Chevrolet Colorado and Malibu, 2017-2018 GMC Acadia, 2018 Buick LaCrosse, Cadillac ATS, Chevrolet Equinox, and GMC Terrain vehicles. The high pressure fuel pump may detach from its mounting flange, possibly resulting in the pump damaging the high pressure fuel line.
Risk. A damaged fuel line can create a fuel leak, increasing the risk of a fire.
Fix. GM will notify owners, and dealers will replace the high pressure fuel pump, and high pressure fuel pipe, free of charge. The recall began July 2, 2018. Owners may contact Buick customer service at 1-800-521-7300, Cadillac customer service at 1-800-458-8006, Chevrolet customer service at 1-800-222-1020, or GMC customer service at 1-800-462-8782. GM's number for this recall is 18188.
Service Brakes, Hydraulic:foundation Components:disc:caliper
What's wrong. General Motors LLC (GM) is recalling certain 2018-2019 Chevrolet Equinox, Impala, Cruze, Volt and Bolt EV vehicles, GMC Terrain vehicles, Buick Lacrosse and Regal vehicles, Cadillac XTS and XTS Professional vehicles and 2018 Chevrolet Malibu vehicles. The rear brake caliper pistons may have an insufficient coating causing gas pockets to form, potentially reducing rear brake performance.
Risk. A reduction of braking performance can increase the risk of a crash.
Fix. GM will notify owners, and dealers will bleed the vehicle's brake system, free of charge. The recall began October 11, 2018. Owners may contact Buick customer service at 1-800-521-7300, Cadillac customer service at 1-800-458-8006, Chevrolet customer service at 1-800-222-1020, or GMC customer service at 1-800-462-8782. GM's number for this recall is 18279.
Air Bags:sensor:occupant Classification
What's wrong. General Motors LLC (GM) is recalling certain 2016-2018 Chevrolet Malibu vehicles. During servicing, a Passenger Presence System (PPS) may have been installed that was not correctly calibrated to the vehicle's seat type. As a result, the PPS may not properly identify an adult passenger from a child passenger in the front passenger seat, potentially causing the air bag to not deploy when it should, or causing the air bag to deploy when it shouldn't.
Risk. In the event of a crash, improper air bag deployment can increase the risk of injury.
Fix. GM will notify owners, and dealers will replace the front passenger PPS seat service kit, free of charge. The recall began August 7, 2018. Owners may contact Chevrolet customer service at 1-800-222-1020. GM's number for this recall is 18208.
2017 Chevrolet Malibu recalls 4
Seat Belts:critical Fasteners
What's wrong. General Motors, LLC (GM) is recalling certain 2016-2021 Chevrolet Malibu and 2019-2021 Cadillac XT4 vehicles. The rear seat belt retractors may be improperly secured with loose or missing fasteners.
Risk. An improperly secured seat belt retractor may not function properly in a crash, increasing the risk of injury.
Fix. Dealers will inspect and tighten the rear seat belt retractors, as necessary, free of charge. Owner notification letters were mailed on September 17, 2021. Owners may contact Chevrolet customer service at 1-800-222-1020 and Cadillac customer service at 1-800-458-8006. GM's number for this recall is N212333380.
Air Bags:side/window
What's wrong. General Motors LLC (GM) is recalling certain 2017 Malibu vehicles manufactured on November 10, 2016. The right-hand rear side air bag inflator manifold may have insufficient welds.
Risk. Insufficient welds could cause the inflator to separate and propel air bag debris into the cabin during a crash. Also, the inflator could fail to inflate during a crash, increasing the risk of injury.
Fix. GM will notify owners, and dealers will replace the rear side air bag modules, free of charge. The recall began on January 25, 2017. Owners may contact Chevrolet customer service at 1-800-222-1020. GM's number for this recall is 16146.
Fuel System, Gasoline:delivery:fuel Pump
What's wrong. General Motors LLC (GM) is recalling certain 2015-2018 GMC Canyon, 2016-2017 Buick Envision, 2016-2018 Chevrolet Colorado and Malibu, 2017-2018 GMC Acadia, 2018 Buick LaCrosse, Cadillac ATS, Chevrolet Equinox, and GMC Terrain vehicles. The high pressure fuel pump may detach from its mounting flange, possibly resulting in the pump damaging the high pressure fuel line.
Risk. A damaged fuel line can create a fuel leak, increasing the risk of a fire.
Fix. GM will notify owners, and dealers will replace the high pressure fuel pump, and high pressure fuel pipe, free of charge. The recall began July 2, 2018. Owners may contact Buick customer service at 1-800-521-7300, Cadillac customer service at 1-800-458-8006, Chevrolet customer service at 1-800-222-1020, or GMC customer service at 1-800-462-8782. GM's number for this recall is 18188.
Air Bags:sensor:occupant Classification
What's wrong. General Motors LLC (GM) is recalling certain 2016-2018 Chevrolet Malibu vehicles. During servicing, a Passenger Presence System (PPS) may have been installed that was not correctly calibrated to the vehicle's seat type. As a result, the PPS may not properly identify an adult passenger from a child passenger in the front passenger seat, potentially causing the air bag to not deploy when it should, or causing the air bag to deploy when it shouldn't.
Risk. In the event of a crash, improper air bag deployment can increase the risk of injury.
Fix. GM will notify owners, and dealers will replace the front passenger PPS seat service kit, free of charge. The recall began August 7, 2018. Owners may contact Chevrolet customer service at 1-800-222-1020. GM's number for this recall is 18208.
2016 Chevrolet Malibu recalls 9
Seat Belts:critical Fasteners
What's wrong. General Motors, LLC (GM) is recalling certain 2016-2021 Chevrolet Malibu and 2019-2021 Cadillac XT4 vehicles. The rear seat belt retractors may be improperly secured with loose or missing fasteners.
Risk. An improperly secured seat belt retractor may not function properly in a crash, increasing the risk of injury.
Fix. Dealers will inspect and tighten the rear seat belt retractors, as necessary, free of charge. Owner notification letters were mailed on September 17, 2021. Owners may contact Chevrolet customer service at 1-800-222-1020 and Cadillac customer service at 1-800-458-8006. GM's number for this recall is N212333380.
Air Bags:frontal
What's wrong. General Motors LLC (GM) is recalling certain model year 2016 Chevrolet Colorado vehicles manufactured January 19, 2016, to February 2, 2016, Chevrolet Malibu vehicles manufactured January 9, 2016, to January 26, 2016, and 2016 GMC Canyon vehicles manufactured January 21, 2016, to February 4, 2016. The driver frontal air bag may improperly inflate during second-stage deployment in the event of a high speed crash.
Risk. An improperly inflated air bag increases the risk of injury.
Fix. GM will notify owners, and dealers will replace the driver side frontal air bag module, free of charge. The recall began on April 14, 2016. Owners may contact Chevrolet customer service at 1-800-222-1020, and GMC customer service at 1-800-462-8782. GM's number for this recall is 28030.
Air Bags:side/window
What's wrong. General Motors LLC (GM) is recalling certain 2016 Malibu vehicles manufactured February 16, 2016, to March 5, 2016. The two weld studs that mount the front and rear side impact air bags may fracture and separate from the air bag during deployment. As such, these vehicles fail to comply with the requirements of the Federal Motor Vehicle Safety Standard (FMVSS) No. 214, "Side Impact Protection."
Risk. Fractured weld studs may allow the side air bag to move out of position during deployment, increasing the risk of injury.
Fix. GM will notify owners, and dealers will replace the side air bag modules, free of charge. The recall began on April 14, 2016. Owners may contact Chevrolet customer service at 1-800-222-1020. GM's number for this recall is 31820.
Electrical System:software
What's wrong. Genera Motors LLC (GM) is recalling certain model year 2016 Chevrolet Camaro, Malibu, Silverado and GMC Sierra vehicles. The radio may intermittently fail to provide an audio warning when the key has been left in the ignition and the door is opened or when the driver does not fasten their seat belt. As such, these vehicles fail to comply with the requirements of Federal Motor Vehicle Safety Standards (FMVSS) number 114, "Theft Protection", and/or 208, "Occupant Crash Protection."
Risk. An unbelted driver is at a greater risk of injury in a crash.
Fix. GM will notify owners, and dealers will update the radio software, free of charge. The recall began on March 14, 2016. Owners may contact Chevrolet customer service at 1-800-222-1020, or GMC customer service at 1-800-462-8782. GM's number for this recall is 15808.
Electrical System:ignition
What's wrong. General Motors LLC (GM) is recalling certain model year 2016-2017 Buick Verano and 2016 Chevrolet Malibu as the electronic park lock lever may allow the ignition key to be removed without the transmission being in PARK. Also, certain 2013 Buick Encore, 2011 Buick Regal, 2013-2014 Buick Verano, 2011-2016 Chevrolet Cruze, 2010-2013 Chevrolet Equinox 2013-2015 Chevrolet Malibu, and 2011-2013 GMC Terrain vehicles may have been serviced with similar defective replacement electronic park lock levers. As such, these vehicles fail to comply with the requirements of Federal Motor Vehicle Safety Standard (FMVSS) number 114, "Theft Protection and Rollaway Prevention."
Risk. If the key is removed without the transmission in PARK, the vehicle may rollaway as occupants are exiting, increasing the risk of injury.
Fix. GM will notify owners, and dealers will inspect and if necessary replace the key cylinder lock housing, free of charge. The recall began on October 14, 2016. Owners may contact Chevrolet customer service at 1-800-222-1020, Buick 1-800-521-7300, and GMC 1-800-462-8782. GM's number for this recall is 50490 and 50491.
Air Bags:side/window
What's wrong. General Motors LLC (GM) is recalling certain model year 2016 Chevrolet Malibu vehicles manufactured November 18, 2015, to June 7, 2016. The fabric of the side-impact air bag cushion may tear during deployment.
Risk. If the air bag tears during deployment, the air bag may not perform as designed, increasing the risk of injury in the event of a crash.
Fix. GM will notify owners, and dealers will inspect and, as necessary, replace the air bag module, free of charge. The recall began October 27, 2016. Owners may contact Chevrolet customer service at 1-800-222-1020. GM's number for this recall is 16079.
Electronic Stability Control (esc)
What's wrong. General Motors LLC (GM) is recalling certain model year 2016 Chevrolet Malibu vehicles manufactured March 7, 2016, through March 12, 2016. The memory chip in the electronic brake control module (EBCM) may fail and cause the loss of electronically controlled brake systems including anti-lock brakes (ABS) and electronic stability control (ESC). As such, these vehicles fail to conform to Federal Motor Vehicle Safety Standard (FMVSS) number 126, "Electronic Stability Control Systems."
Risk. If the EBCM fails the primary braking system will still function, however, the loss of ABS and ESC increase the risk of a crash.
Fix. GM will notify owners, and dealers will install a replacement EBCM, free of charge. The recall began on June 17, 2016. Owners may contact Chevrolet customer service at 1-800-222-1020). GM's number for this recall is 39440.
Fuel System, Gasoline:delivery:fuel Pump
What's wrong. General Motors LLC (GM) is recalling certain 2015-2018 GMC Canyon, 2016-2017 Buick Envision, 2016-2018 Chevrolet Colorado and Malibu, 2017-2018 GMC Acadia, 2018 Buick LaCrosse, Cadillac ATS, Chevrolet Equinox, and GMC Terrain vehicles. The high pressure fuel pump may detach from its mounting flange, possibly resulting in the pump damaging the high pressure fuel line.
Risk. A damaged fuel line can create a fuel leak, increasing the risk of a fire.
Fix. GM will notify owners, and dealers will replace the high pressure fuel pump, and high pressure fuel pipe, free of charge. The recall began July 2, 2018. Owners may contact Buick customer service at 1-800-521-7300, Cadillac customer service at 1-800-458-8006, Chevrolet customer service at 1-800-222-1020, or GMC customer service at 1-800-462-8782. GM's number for this recall is 18188.
Air Bags:sensor:occupant Classification
What's wrong. General Motors LLC (GM) is recalling certain 2016-2018 Chevrolet Malibu vehicles. During servicing, a Passenger Presence System (PPS) may have been installed that was not correctly calibrated to the vehicle's seat type. As a result, the PPS may not properly identify an adult passenger from a child passenger in the front passenger seat, potentially causing the air bag to not deploy when it should, or causing the air bag to deploy when it shouldn't.
Risk. In the event of a crash, improper air bag deployment can increase the risk of injury.
Fix. GM will notify owners, and dealers will replace the front passenger PPS seat service kit, free of charge. The recall began August 7, 2018. Owners may contact Chevrolet customer service at 1-800-222-1020. GM's number for this recall is 18208.
2015 Chevrolet Malibu recalls 3
Visibility:sun/moon Roof Assembly
What's wrong. General Motors LLC (GM) is recalling certain model year 2013-2015 Chevrolet Malibu vehicles October 24, 2011, to March 5, 2015. In the affected vehicles, the Slide or Tilt switch for the roof panel may not be adequately recessed to prevent the switch from inadvertently being pressed. As such, these vehicles fail to comply with the requirements of Federal Motor Vehicle Safety Standard (FMVSS) No. 118, "Power-Operated Window, Partition, and Roof Panel Systems."
Risk. The Slide or Tilt roof panel switch may inadvertently be pressed and the roof panel may auto-close unexpectedly, increasing the risk of a pinch injury.
Fix. GM will notify owners, and dealers will update the Body Control Module (BCM) software to remove auto-close feature for certain switch positions, free of charge. The recall began April 21, 2015. Owners may contact Chevrolet customer service at 1-800-222-1020. GM's number for this recall is 15176.
Air Bags:side/window
What's wrong. General Motors LLC (GM) is recalling certain model year 2015 Buick LaCrosse, Cadillac XTS, Chevrolet Camaro, Equinox, Malibu, and GMC Terrain vehicles. The affected vehicles have front seat-mounted side impact air bags whose inflator may rupture upon its deployment.
Risk. In the event of a crash necessitating deployment of one or both of the side impact air bags, the air bag's inflator may rupture and the air bag may not properly inflate. The rupture could cause metal fragments to strike the vehicle occupants, potentially resulting in serious injury or death. Additionally, if the air bag does not properly inflate, the driver or passenger is at an increased risk of injury.
Fix. GM will notify owners, and dealers will replace the side impact air bag modules, free of charge. The recall began on October 19, 2015. Owners may contact Buick customer service at 1-800-521-7300, Chevrolet customer service at 1-800-222-1020, Cadillac customer service at 1-800-458-8006, or GMC customer service at 1-800-462-8782. GM's number for this recall is 01320.
Electrical System:ignition
What's wrong. General Motors LLC (GM) is recalling certain model year 2016-2017 Buick Verano and 2016 Chevrolet Malibu as the electronic park lock lever may allow the ignition key to be removed without the transmission being in PARK. Also, certain 2013 Buick Encore, 2011 Buick Regal, 2013-2014 Buick Verano, 2011-2016 Chevrolet Cruze, 2010-2013 Chevrolet Equinox 2013-2015 Chevrolet Malibu, and 2011-2013 GMC Terrain vehicles may have been serviced with similar defective replacement electronic park lock levers. As such, these vehicles fail to comply with the requirements of Federal Motor Vehicle Safety Standard (FMVSS) number 114, "Theft Protection and Rollaway Prevention."
Risk. If the key is removed without the transmission in PARK, the vehicle may rollaway as occupants are exiting, increasing the risk of injury.
Fix. GM will notify owners, and dealers will inspect and if necessary replace the key cylinder lock housing, free of charge. The recall began on October 14, 2016. Owners may contact Chevrolet customer service at 1-800-222-1020, Buick 1-800-521-7300, and GMC 1-800-462-8782. GM's number for this recall is 50490 and 50491.
2014 Chevrolet Malibu recalls 6
Visibility:defroster/defogger/hvac System
What's wrong. General Motors LLC (GM) is recalling certain model year 2014 Chevrolet Malibu vehicles manufactured June 12, 2013, through November 5, 2013. The heating, ventilation, and air conditioning (HVAC) control in these vehicles may intermittently become inoperable when the vehicle is started, preventing the windshield defroster from working. Thus, these vehicles fail to conform to the requirements of Federal Motor Vehicle Safety Standard (FMVSS) No. 103, "Windshield Defrosting and Defogging Systems."
Risk. The inability to turn on the windshield defroster may decrease the driver's visibility thereby increasing the risk of a crash.
Fix. GM will notify owners, and dealers will update the electronic climate control module software, free of charge. The recall began during December 2013. Owners may contact GM at 1-800-521-7300. GM's recall campaign number is 13380.
Service Brakes, Hydraulic:power Assist:vacuum
What's wrong. General Motors LLC (GM) is recalling certain model year 2014 Chevrolet Malibu vehicles manufactured June 12, 2013, through May 2, 2014, and equipped with a 2.5L engine with the auto stop/start option. The affected vehicles may experience a complete loss of brake vacuum assist, disabling the hydraulic boost assist. As such, these vehicles do not comply with Federal Motor Vehicle Safety Standard (FMVSS) number 135, "Light Vehicle Brake Systems."
Risk. If the hydraulic boost assist is disabled, slowing or stopping the vehicle will require additional brake pedal effort and a lengthened stopping distance. Both of these effects increase the risk of a crash.
Fix. GM will notify owners, and dealers will update the electronic brake control module software, free of charge. The recall began on July 3, 2014. Owners may contact General Motors customer service at 1-800-222-1020. General Motors number for this recall is 14201.
Power Train:automatic Transmission
What's wrong. General Motors LLC (GM) is recalling certain model year 2014 Buick Regal, LaCrosse, Verano, and Enclave, and Chevrolet Impala, Malibu, Cruze, and Traverse, and GMC Acadia vehicles equipped with automatic transmissions. In the affected vehicles, the transmission shift cable adjuster may disengage from the transmission shift lever. As such, these vehicles do not conform to Federal Motor Vehicle Safety Standard (FMVSS) number 102, "Transmission Shift Lever Sequence, Starter Interlock, and Transmission Braking Effect." They also fail to conform to FMVSS number 114, "Theft Protection and Rollaway Prevention."
Risk. If a vehicle's shift cable disengages from the transmission shift lever, a driver may be unable to shift gear positions and the indicated shift position may not represent the gear position the vehicle is in. Should a disengagement occur while the vehicle is being driven, when the driver goes to stop and park the vehicle, the driver may be able to shift the lever to the "PARK" position, but the vehicle transmission may not be in the "PARK" gear position. If the vehicle is not in the "PARK" position there is a risk the vehicle will roll away as the driver and other occupants exit the vehicle or anytime thereafter. A vehicle rollaway increases the risk of injury to exiting occupants and bystanders.
Fix. General Motors will notify owners, and dealers will inspect and replace any affected transmission shift cable adjusters, free of charge. The recall began on April 10, 2014. Chevrolet owners may contact General Motors at 1-800-222-1020, Buick owners at 1-800-521-7300, and GMC owners at 1-800-462-8782. General Motors' number associated with this recall is 14048.
Visibility:sun/moon Roof Assembly
What's wrong. General Motors LLC (GM) is recalling certain model year 2013-2015 Chevrolet Malibu vehicles October 24, 2011, to March 5, 2015. In the affected vehicles, the Slide or Tilt switch for the roof panel may not be adequately recessed to prevent the switch from inadvertently being pressed. As such, these vehicles fail to comply with the requirements of Federal Motor Vehicle Safety Standard (FMVSS) No. 118, "Power-Operated Window, Partition, and Roof Panel Systems."
Risk. The Slide or Tilt roof panel switch may inadvertently be pressed and the roof panel may auto-close unexpectedly, increasing the risk of a pinch injury.
Fix. GM will notify owners, and dealers will update the Body Control Module (BCM) software to remove auto-close feature for certain switch positions, free of charge. The recall began April 21, 2015. Owners may contact Chevrolet customer service at 1-800-222-1020. GM's number for this recall is 15176.
Service Brakes, Hydraulic:foundation Components:disc
What's wrong. General Motors LLC (GM) is recalling certain model year 2014 Buick Lacrosse vehicles manufactured January 29, 2014, through March 31, 2014 and 2014 Chevrolet Malibu vehicles manufactured February 7, 2014, through March 31, 2014, and equipped with 17 inch front brake rotors. The affected vehicles may have had brake rotors intended for the rear of the car accidentally installed on the front. The rear rotors, while the same diameter, are thinner and may result in a front brake pad detaching from the caliper.
Risk. If a brake pad detaches from caliper, there may be a sudden reduction in braking, lengthening the distance required to stop the vehicle and increasing the risk of a crash.
Fix. GM will notify owners, and dealers will inspect the front brake rotors, and install the correct rotors with new brake pads, as necessary, free of charge. The recall began on June 20, 2014. Owners may contact General Motors customer service at 1-800-521-7300 (Buick) or 1-800-222-1020 (Chevrolet). GM's number for this recall is 14128.
Electrical System:ignition
What's wrong. General Motors LLC (GM) is recalling certain model year 2016-2017 Buick Verano and 2016 Chevrolet Malibu as the electronic park lock lever may allow the ignition key to be removed without the transmission being in PARK. Also, certain 2013 Buick Encore, 2011 Buick Regal, 2013-2014 Buick Verano, 2011-2016 Chevrolet Cruze, 2010-2013 Chevrolet Equinox 2013-2015 Chevrolet Malibu, and 2011-2013 GMC Terrain vehicles may have been serviced with similar defective replacement electronic park lock levers. As such, these vehicles fail to comply with the requirements of Federal Motor Vehicle Safety Standard (FMVSS) number 114, "Theft Protection and Rollaway Prevention."
Risk. If the key is removed without the transmission in PARK, the vehicle may rollaway as occupants are exiting, increasing the risk of injury.
Fix. GM will notify owners, and dealers will inspect and if necessary replace the key cylinder lock housing, free of charge. The recall began on October 14, 2016. Owners may contact Chevrolet customer service at 1-800-222-1020, Buick 1-800-521-7300, and GMC 1-800-462-8782. GM's number for this recall is 50490 and 50491.
2013 Chevrolet Malibu recalls 10
Suspension:rear
What's wrong. General Motors, LLC (GM) is recalling certain 2010-2013 Buick Lacrosse, 2012-2013 Buick Regal, and 2013 Chevrolet Malibu vehicles sold or ever registered in Connecticut, Delaware, the District of Columbia, Illinois, Indiana, Iowa, Kentucky, Maine, Maryland, Massachusetts, Michigan, Minnesota, Missouri, New Hampshire, New Jersey, New York, Ohio, Pennsylvania, Rhode Island, Vermont, Virginia, West Virginia, or Wisconsin. These vehicles may have rear toe links that received an improper amount of electrocoating (e-coat) corrosion protection, which could cause the e-coat to become brittle and break away when contacted by road debris. Over time, the e-coat may chip away, exposing the metal toe link and making it more susceptible to corrosion. Corrosion may eventually cause the toe link to thin and ultimately fracture.
Risk. A rear toe link fracture may reduce the driver's ability to control the vehicle, increasing the risk of a crash.
Fix. Dealers will replace the rear suspension toe links and adjuster fasteners, free of charge. Owner notification letters were mailed January 27, 2022. Owners may contact Buick customer service at 1-800-521-7300 or Chevrolet customer service at 1-800-222-1020. GM's number for this recall is N212346640. This recall is an expansion of NHTSA recalls 20V-764 and 21V-633.
Suspension:rear
What's wrong. General Motors, LLC (GM) is recalling certain 2013 Buick Regal, Chevrolet Malibu, and Buick Lacrosse vehicles sold or ever registered in Connecticut, Delaware, the District of Columbia, Illinois, Indiana, Iowa, Kentucky, Maine, Maryland, Massachusetts, Michigan, Minnesota, Missouri, New Hampshire, New Jersey, New York, Ohio, Pennsylvania, Rhode Island, Vermont, Virginia, West Virginia, or Wisconsin. These vehicles may have rear toe links that received excessive electrocoating (e-coat) corrosion protection, which could cause the e-coat to become brittle and break away when contacted by road debris. Over time, the e-coat may chip away, exposing the metal toe link and making it more susceptible to corrosion. Corrosion may eventually cause the toe link to thin and ultimately fracture.
Risk. A rear toe link fracture may reduce the driver's ability to control the vehicle, increasing the risk of a crash.
Fix. Dealers will replace the rear suspension toe links and adjuster fasteners, free of charge. Interim owner notification letters were mailed on September 30, 2021. Owner notification letters were mailed on January 3, 2022. Owners may contact Buick customer service at 1-800-521-7300 or Chevrolet customer service at 1-800-222-1020. GM's number for this recall is N212330130.
Suspension:rear
What's wrong. General Motors, LLC (GM) is recalling certain 2012-2013 Buick Regal, 2013 Chevrolet Malibu, and 2010-2013 Buick Lacrosse vehicles sold or ever registered in Connecticut, Delaware, the District of Columbia, Illinois, Indiana, Iowa, Kentucky, Maine, Maryland, Massachusetts, Michigan, Minnesota, Missouri, New Hampshire, New Jersey, New York, Ohio, Pennsylvania, Rhode Island, Vermont, Virginia, West Virginia, or Wisconsin. These vehicles may have rear toe links that received excessive electrocoating (e-coat) corrosion protection, which could cause the e-coat to become brittle and break away when contacted by road debris. Over time, the e-coat may chip away, exposing the metal toe link and making it more susceptible to corrosion. Corrosion may eventually cause the toe link to thin and ultimately to fracture.
Risk. A rear toe link fracture may reduce the driver's ability to control the vehicle, increasing the risk of a crash.
Fix. GM will notify owners, and dealers will replace the rear suspension toe links and adjuster fasteners free of charge. Parts are not currently available. Owners were mailed an interim notification on January 27, 2021, and April 15, 2021. A third notification was mailed on August 19, 201. Owners may contact Buick customer service at 1-800-521-7300 or Chevrolet customer service at 1-800-222-1020. GM's number for this recall is N202308930.
Electrical System:software
What's wrong. General motors (gm) is recalling certain model year 2013 chevrolet malibu vehicles manufactured from october 24, 2011, through march 31, 2012. After an event of hard braking, the sensing and diagnostic module (sdm) may reset itself.
Risk. If this occurs during an aggressive turning maneuver, and then afterwards a potential vehicle rollover event is sensed, the roof rail airbag may unintentionally deploy. Additionally, the air bags and/or seatbelt pretensioners may not deploy during a severe crash, increasing the risk of personal injury.
Fix. Gm will notify owners, and dealers will reprogram the sdm. This service will be performed free of charge. The safety recall began on june 13, 2012.
Suspension:rear
What's wrong. General Motors is recalling certain model year 2013 Chevrolet Malibu vehicles, manufactured December 6, 2011, through January 15, 2013. One or more rear suspension bolts may not have been tightened to the specified torque. This may lead to sudden changes in vehicle handling.
Risk. Sudden changes in vehicle handling may increase the risk of a crash.
Fix. General Motors will notify owners, and dealers will inspect and retighten the bolts as necessary, free of charge. Owner notifications have already begun and will be completed shortly. Owners may contact General Motors at 1-800-521-7300.
Electrical System:wiring
What's wrong. General Motors LLC (GM) is recalling certain model year 2013 Chevrolet Malibu vehicles manufactured October 25, 2011, through June 29, 2012 and equipped with the 8-way power adjustable front seat feature. The wiring harness for the power seat may contact the seat frame which may chafe the harness.
Risk. If the harness is chaffed enough to expose the wires, a short circuit could occur, resulting unintended movement of the seat, the seat to become inoperative, sparking under the seat, flickering lights, smoke, or possibly a fire.
Fix. GM will notify owners, and dealers will inspect the wire harness and repair and secure it as necessary, free of charge. The recall began during December 2013. Owners may contact GM at 1-800-521-7300. GM's recall campaign number is 13342.
Exterior Lighting:turn Signal
What's wrong. General Motors LLC (GM) is recalling certain model year 2011-2013 Buick Regal and model year 2013 Chevrolet Malibu vehicles. These vehicles are equipped with two turn signal bulbs in each front turn signal. If one of the two front turn signal bulbs burn out in either front turn signal lamp, there is no indication to the driver. As such, these vehicles fail to comply with the requirements of Federal Motor Vehicle Safety Standard No. 108, "Lamps, Reflective Devices, and Associated Equipment."
Risk. If the driver is not aware that a turn signal is not functioning properly, the driver may continue to drive the vehicle. If half of a front turn signal is not illuminating, other driver's may not be aware that the affected vehicle is turning, thereby increasing the risk of a crash.
Fix. GM will notify owners, dealers will update the body control module software, free of charge. The recall began in September 2014. Owners may contact Buick at 1-800-521-7300 or Chevrolet at 1-800-222-1020. GM's number for this recall is 12212.
Power Train:automatic Transmission:gear Position Indication (prndl)
What's wrong. General Motors LLC (GM) is recalling certain model year 2013 Chevrolet Malibu vehicles manufactured April 10, 2012, to August 2, 2012. In the affected vehicles, the console transmission gear selection indicator may not illuminate the shift position selected. As such, these vehicles fail to comply with the requirements of Federal Motor Vehicle Safety Standard (FMVSS) number 102, "Transmission Shift Position Sequence, Starter Interlock, and Transmission Braking Effect."
Risk. If the console shift indicator does not illuminate the transmission gear selection, a driver could inadvertently select a transmission position other than the position the driver intended, increasing the risk of a crash.
Fix. GM has notified owners, and dealers will replace the transmission gear selection control module, free of charge. The recall began on April 20, 2015. Owners may contact Chevrolet customer service at 1-800-222-1020. GM's number for this recall is 12162.
Visibility:sun/moon Roof Assembly
What's wrong. General Motors LLC (GM) is recalling certain model year 2013-2015 Chevrolet Malibu vehicles October 24, 2011, to March 5, 2015. In the affected vehicles, the Slide or Tilt switch for the roof panel may not be adequately recessed to prevent the switch from inadvertently being pressed. As such, these vehicles fail to comply with the requirements of Federal Motor Vehicle Safety Standard (FMVSS) No. 118, "Power-Operated Window, Partition, and Roof Panel Systems."
Risk. The Slide or Tilt roof panel switch may inadvertently be pressed and the roof panel may auto-close unexpectedly, increasing the risk of a pinch injury.
Fix. GM will notify owners, and dealers will update the Body Control Module (BCM) software to remove auto-close feature for certain switch positions, free of charge. The recall began April 21, 2015. Owners may contact Chevrolet customer service at 1-800-222-1020. GM's number for this recall is 15176.
Electrical System:ignition
What's wrong. General Motors LLC (GM) is recalling certain model year 2016-2017 Buick Verano and 2016 Chevrolet Malibu as the electronic park lock lever may allow the ignition key to be removed without the transmission being in PARK. Also, certain 2013 Buick Encore, 2011 Buick Regal, 2013-2014 Buick Verano, 2011-2016 Chevrolet Cruze, 2010-2013 Chevrolet Equinox 2013-2015 Chevrolet Malibu, and 2011-2013 GMC Terrain vehicles may have been serviced with similar defective replacement electronic park lock levers. As such, these vehicles fail to comply with the requirements of Federal Motor Vehicle Safety Standard (FMVSS) number 114, "Theft Protection and Rollaway Prevention."
Risk. If the key is removed without the transmission in PARK, the vehicle may rollaway as occupants are exiting, increasing the risk of injury.
Fix. GM will notify owners, and dealers will inspect and if necessary replace the key cylinder lock housing, free of charge. The recall began on October 14, 2016. Owners may contact Chevrolet customer service at 1-800-222-1020, Buick 1-800-521-7300, and GMC 1-800-462-8782. GM's number for this recall is 50490 and 50491.
2012 Chevrolet Malibu recalls 3
Steering
What's wrong. Dorman Products, Inc. (Dorman) is recalling certain replacement intermediate steering shafts sold under the Dorman, OE Solutions, and Solutions brand names, part numbers 425-167, 2425167, and 7-3074, for installation on 2004-2012 Chevrolet Malibu, 2005-2010 Pontiac G6, and 2007-2009 Saturn Aura vehicles. The affected steering shafts may have a yoke that inadequately supports the u-joint bearing resulting in a premature failure.
Risk. A joint bearing that fails prematurely may cause separation of the u-joint resulting in a complete loss of steering control, increasing the risk of a crash.
Fix. Dorman will notify owners, and dealers will refund the purchase price or replace the steering shafts, free of charge. The recall began in September 2014. Owners may contact Dorman customer service at 1-800-523-2492.
Electrical System:wiring
What's wrong. General Motors LLC (GM) is recalling certain model year 2004-2012 Chevrolet Malibu vehicles manufactured May 16, 2003, through October 11, 2012, 2004-2007 Malibu Maxx vehicles manufactured June 25, 2003, through April 5, 2007, 2005-2010 Pontiac G6 vehicles manufactured May 26, 2004, through January 4, 2010, and 2007-2010 Saturn Aura vehicles manufactured April 24, 2006, through May 26, 2009. In the affected vehicles, increased resistance in the Body Control Module (BCM) connection may result in voltage fluctuations in the Brake Apply Sensor (BAS) circuit. These fluctuations can cause one or more of these conditions: the brake lights to illuminate without the brake pedal being pushed; the brake lights to not illuminate when the pedal is pushed; difficulty disengaging the cruise control; moving the gear shifter out of the 'PARK' position without pushing the brake; and disablement of crash avoidance features such as traction control, electronic stability control, and panic braking assist features.
Risk. Any of the above failure conditions increases the risk of a crash.
Fix. GM will notify owners, and dealers will attach the wiring harness to the BCM with a spacer, apply dielectric lubricant to both the BCM and harness connector and the BAS and harness connector, and will relearn the brake pedal home position, free of charge. The manufacturer distributed an Interim letter to customers on July 14, 2014. The recall began on August 18, 2014. Owners may contact General Motors customer service at 1-800-222-1020 (Chevrolet), 1-800-762-2737 (Pontiac), 1-800-553-6000 (Saturn). GM's number for this recall is 13036.
Seat Belts
What's wrong. General Motors LLC (GM) is recalling certain model year 2011-2012 Chevrolet Malibu vehicles manufactured April 8, 2010, to October 11, 2012. In the affected vehicles, the flexible steel cables that connect the seat belts to the vehicle at the outside of the driver seat and the front passenger seat may be bent from being sat on while entering the vehicle. This repeated bending may result in the cable breaking.
Risk. If the cable breaks, the seat occupant may not be properly restrained in the event of a crash, increasing their risk of injury.
Fix. GM will notify owners, and dealers will replace the outboard lap anchor mounting bracket and inspect the flexible steel cable, replacing it as necessary, free of charge. The recall began on November 16, 2015. Owners may contact Chevrolet customer service at 1-800-222-1020. GM's number for this recall is 15031.
2011 Chevrolet Malibu recalls 4
Seat Belts
What's wrong. General Motors LLC (GM) is recalling certain model year 2011-2012 Chevrolet Malibu vehicles manufactured April 8, 2010, to October 11, 2012. In the affected vehicles, the flexible steel cables that connect the seat belts to the vehicle at the outside of the driver seat and the front passenger seat may be bent from being sat on while entering the vehicle. This repeated bending may result in the cable breaking.
Risk. If the cable breaks, the seat occupant may not be properly restrained in the event of a crash, increasing their risk of injury.
Fix. GM will notify owners, and dealers will replace the outboard lap anchor mounting bracket and inspect the flexible steel cable, replacing it as necessary, free of charge. The recall began on November 16, 2015. Owners may contact Chevrolet customer service at 1-800-222-1020. GM's number for this recall is 15031.
Steering
What's wrong. Dorman Products, Inc. (Dorman) is recalling certain replacement intermediate steering shafts sold under the Dorman, OE Solutions, and Solutions brand names, part numbers 425-167, 2425167, and 7-3074, for installation on 2004-2012 Chevrolet Malibu, 2005-2010 Pontiac G6, and 2007-2009 Saturn Aura vehicles. The affected steering shafts may have a yoke that inadequately supports the u-joint bearing resulting in a premature failure.
Risk. A joint bearing that fails prematurely may cause separation of the u-joint resulting in a complete loss of steering control, increasing the risk of a crash.
Fix. Dorman will notify owners, and dealers will refund the purchase price or replace the steering shafts, free of charge. The recall began in September 2014. Owners may contact Dorman customer service at 1-800-523-2492.
Electrical System:wiring
What's wrong. General Motors LLC (GM) is recalling certain model year 2004-2012 Chevrolet Malibu vehicles manufactured May 16, 2003, through October 11, 2012, 2004-2007 Malibu Maxx vehicles manufactured June 25, 2003, through April 5, 2007, 2005-2010 Pontiac G6 vehicles manufactured May 26, 2004, through January 4, 2010, and 2007-2010 Saturn Aura vehicles manufactured April 24, 2006, through May 26, 2009. In the affected vehicles, increased resistance in the Body Control Module (BCM) connection may result in voltage fluctuations in the Brake Apply Sensor (BAS) circuit. These fluctuations can cause one or more of these conditions: the brake lights to illuminate without the brake pedal being pushed; the brake lights to not illuminate when the pedal is pushed; difficulty disengaging the cruise control; moving the gear shifter out of the 'PARK' position without pushing the brake; and disablement of crash avoidance features such as traction control, electronic stability control, and panic braking assist features.
Risk. Any of the above failure conditions increases the risk of a crash.
Fix. GM will notify owners, and dealers will attach the wiring harness to the BCM with a spacer, apply dielectric lubricant to both the BCM and harness connector and the BAS and harness connector, and will relearn the brake pedal home position, free of charge. The manufacturer distributed an Interim letter to customers on July 14, 2014. The recall began on August 18, 2014. Owners may contact General Motors customer service at 1-800-222-1020 (Chevrolet), 1-800-762-2737 (Pontiac), 1-800-553-6000 (Saturn). GM's number for this recall is 13036.
Air Bags:frontal:driver Side:inflator Module
What's wrong. General Motors LLC (GM) is recalling certain 2010-2011 Chevrolet Malibu vehicles. In the event of a crash necessitating deployment of the driver frontal air bag, the air bag inflator may explode due to being overpressurized.
Risk. If the inflator explodes, sharp metal fragments may strike the driver or other occupants resulting in serious injury or death.
Fix. GM has notified owners, and dealers will replace the front driver air bag module, free of charge. The recall began February 25, 2019. Owners may contact GM customer service at 1-800-522-9559. GM's number for this recall is N182206630.
2010 Chevrolet Malibu recalls 4
Power Train:automatic Transmission:gear Position Indication (prndl)
What's wrong. General Motors (GM) is recalling certain model year 2007-2010 Saturn Aura and model year 2008-2010 Chevrolet Malibu and Pontiac G6 vehicles, equipped with a 4-speed automatic transmission. On these vehicles, the tabs on the transmission shift cable end may fracture and separate.
Risk. If the tabs were to fracture and separate, the shift lever and the actual position of the transmission gear may not match. The driver would be able to move the shifter to 'PARK' and remove the ignition key, but the transmission gear may not be in 'PARK.' The vehicle may not be able to be restarted and the vehicle could roll away after the driver has exited the vehicle, resulting in a possible crash without prior warning.
Fix. GM will notify owners, and dealers will install a retainer over the cable end or replace the shift cable as necessary. This service will be performed free of charge. Notification to owners began on on November 9, 2012. Owners were instructed to not bring their vehicles for repair until January 2013. Owners may contact General Motors at 1-800-521-7300.
Steering
What's wrong. Dorman Products, Inc. (Dorman) is recalling certain replacement intermediate steering shafts sold under the Dorman, OE Solutions, and Solutions brand names, part numbers 425-167, 2425167, and 7-3074, for installation on 2004-2012 Chevrolet Malibu, 2005-2010 Pontiac G6, and 2007-2009 Saturn Aura vehicles. The affected steering shafts may have a yoke that inadequately supports the u-joint bearing resulting in a premature failure.
Risk. A joint bearing that fails prematurely may cause separation of the u-joint resulting in a complete loss of steering control, increasing the risk of a crash.
Fix. Dorman will notify owners, and dealers will refund the purchase price or replace the steering shafts, free of charge. The recall began in September 2014. Owners may contact Dorman customer service at 1-800-523-2492.
Electrical System:wiring
What's wrong. General Motors LLC (GM) is recalling certain model year 2004-2012 Chevrolet Malibu vehicles manufactured May 16, 2003, through October 11, 2012, 2004-2007 Malibu Maxx vehicles manufactured June 25, 2003, through April 5, 2007, 2005-2010 Pontiac G6 vehicles manufactured May 26, 2004, through January 4, 2010, and 2007-2010 Saturn Aura vehicles manufactured April 24, 2006, through May 26, 2009. In the affected vehicles, increased resistance in the Body Control Module (BCM) connection may result in voltage fluctuations in the Brake Apply Sensor (BAS) circuit. These fluctuations can cause one or more of these conditions: the brake lights to illuminate without the brake pedal being pushed; the brake lights to not illuminate when the pedal is pushed; difficulty disengaging the cruise control; moving the gear shifter out of the 'PARK' position without pushing the brake; and disablement of crash avoidance features such as traction control, electronic stability control, and panic braking assist features.
Risk. Any of the above failure conditions increases the risk of a crash.
Fix. GM will notify owners, and dealers will attach the wiring harness to the BCM with a spacer, apply dielectric lubricant to both the BCM and harness connector and the BAS and harness connector, and will relearn the brake pedal home position, free of charge. The manufacturer distributed an Interim letter to customers on July 14, 2014. The recall began on August 18, 2014. Owners may contact General Motors customer service at 1-800-222-1020 (Chevrolet), 1-800-762-2737 (Pontiac), 1-800-553-6000 (Saturn). GM's number for this recall is 13036.
Air Bags:frontal:driver Side:inflator Module
What's wrong. General Motors LLC (GM) is recalling certain 2010-2011 Chevrolet Malibu vehicles. In the event of a crash necessitating deployment of the driver frontal air bag, the air bag inflator may explode due to being overpressurized.
Risk. If the inflator explodes, sharp metal fragments may strike the driver or other occupants resulting in serious injury or death.
Fix. GM has notified owners, and dealers will replace the front driver air bag module, free of charge. The recall began February 25, 2019. Owners may contact GM customer service at 1-800-522-9559. GM's number for this recall is N182206630.
2009 Chevrolet Malibu recalls 6
Visibility:defroster/defogger/hvac System
What's wrong. Gm is recalling 77 my 2009 chevrolet malibu hybrid vehicles for failing to comply with the requirements of federal motor vehicle safety standard no. 103, "windshield defrosting and defogging system." the heating, ventilation, and airconditioning (hvac) system may become inoperative. If this were to occur, the blower would not function properly and the mode selector would remain in the last known setting.
Risk. If the windshield began to fog or frost, there may not be enough airflow to clear the windshield, resulting in reduced driver visibility and a possible crash without prior warning.
Fix. Dealers will reprogram the hvac control head module. The recall is expected to begin on december 17, 2008. Owners may contact chevrolet at 1-800-630-2438 or through their website at <a href=http://www.gmownercenter.com>http://www.gmownercenter.com</a> .
Power Train:automatic Transmission:lever And Linkage:column Shift
What's wrong. General motors is recalling 276,729 my 2009 buick enclave, chevrolet cobalt, hhr, malibu, traverse, gmc acadia, pontiac g5, g6 and saturn aura and outlook passenger vehicles. These vehicles fail to comply with federal motor vehicles safety standard 102, "transmission shift position sequence, starter interlock, and transmission braking effect", and fmvss 114, "theft protection and rollaway prevention". On some of these vehicles, the transmission shift cable adjustment clip may not be fully engaged. If the clip is not fully engaged, the shift lever and the actual position of the transmission gear may not match. With this condition, the drive could move the shifter to "park" and remove the ignition key, but the transmission gear may not be in "park".
Risk. The driver may not be able to restart the vehicle and the vehicle could roll away after the driver has exited the vehicle, resulting in a possible crash without prior warning.
Fix. Dealers will inspect and ensure that the shift cable adjustment clip is fully engaged. In the event that the clip does not engage, the shift cable will be replaced free of charge. The recall is expected to begin on or before march 24, 2009. Owners may contact buick at 1-866-608-8080, chevrolet at 1-800-630-2438, gmc at 1-866-996-9463, pontiac at 1-800-620-7668 and saturn at 1-800-972-8876 or at www.gmownercenter.com.
Power Train:automatic Transmission:gear Position Indication (prndl)
What's wrong. General Motors (GM) is recalling certain model year 2007-2010 Saturn Aura and model year 2008-2010 Chevrolet Malibu and Pontiac G6 vehicles, equipped with a 4-speed automatic transmission. On these vehicles, the tabs on the transmission shift cable end may fracture and separate.
Risk. If the tabs were to fracture and separate, the shift lever and the actual position of the transmission gear may not match. The driver would be able to move the shifter to 'PARK' and remove the ignition key, but the transmission gear may not be in 'PARK.' The vehicle may not be able to be restarted and the vehicle could roll away after the driver has exited the vehicle, resulting in a possible crash without prior warning.
Fix. GM will notify owners, and dealers will install a retainer over the cable end or replace the shift cable as necessary. This service will be performed free of charge. Notification to owners began on on November 9, 2012. Owners were instructed to not bring their vehicles for repair until January 2013. Owners may contact General Motors at 1-800-521-7300.
Steering
What's wrong. Dorman Products, Inc. (Dorman) is recalling certain replacement intermediate steering shafts sold under the Dorman, OE Solutions, and Solutions brand names, part numbers 425-167, 2425167, and 7-3074, for installation on 2004-2012 Chevrolet Malibu, 2005-2010 Pontiac G6, and 2007-2009 Saturn Aura vehicles. The affected steering shafts may have a yoke that inadequately supports the u-joint bearing resulting in a premature failure.
Risk. A joint bearing that fails prematurely may cause separation of the u-joint resulting in a complete loss of steering control, increasing the risk of a crash.
Fix. Dorman will notify owners, and dealers will refund the purchase price or replace the steering shafts, free of charge. The recall began in September 2014. Owners may contact Dorman customer service at 1-800-523-2492.
Steering:electric Power Assist System
What's wrong. General Motors LLC (GM) is recalling certain model year 2004-2006 and 2008-2009 Chevrolet Malibu, 2004-2006 Malibu Maxx, 2009-2010 HHR (non-turbo), 2010 Cobalt, 2008-2009 Saturn Aura and 2004-2007 Ion, and 2005-2009 Pontiac G6. In the affected vehicles, there may be a sudden loss of electric power steering (EPS) assist that could occur at any time while driving.
Risk. If power steering assist is lost, greater driver effort would be required to steer the vehicle at low speeds, increasing the risk of a crash.
Fix. GM will notify owners, and dealers will perform one of four bulletins. Parts are not currently available. GM expects to send an interim notification around May 28, 2014. When parts are available, owners will be mailed a second letter to come in to have the applicable bulletin applied. Bulletin 14115 covers model year 2004-2007 Saturn Ion, 2009-2010 Chevrolet HHR and 2010 Chevrolet Cobalts. Dealers will replace the EPS motor. Bulletin 14116 covers model year 2004-2006 Chevrolet Malibu and Malibu Maxx, 2005-2006 Pontiac G6 and 2008-2009 Chevrolet Malibu, Pontiac G6 and Saturn Aura built from March 1, 2008, through June 27, 2008. Dealers will replace the torque sensor assembly. Bulletin 14117 covers model year 2008 Chevrolet Malibu, Pontiac G6 and Saturn Aura built from February 1, 2008, through February 28, 2008. Dealers will replace the torque sensor assembly and EPS motor controller unit. Bulletin 14118 covers model year 2008 Chevrolet Malibu, Pontiac G6 and Saturn Aura built from October 1, 2007, through January 31, 2008. Dealers will replace the EPS motor controller unit. The recall began on July 17, 2014. Owners may contact Chevrolet at 1-800-630-2438, Saturn at 1-800-553-6000, and Pontiac at 1-800-620-7668. GM's number for this recall is N140115. Note: GM bulletin number 14119 will be implemented for model year 2006-2008 and early production of 2009 Chevrolet HHR (non-turbo) and model year 2003 Saturn ION to provide EPS Motor replacement for the life of the vehicle.
Electrical System:wiring
What's wrong. General Motors LLC (GM) is recalling certain model year 2004-2012 Chevrolet Malibu vehicles manufactured May 16, 2003, through October 11, 2012, 2004-2007 Malibu Maxx vehicles manufactured June 25, 2003, through April 5, 2007, 2005-2010 Pontiac G6 vehicles manufactured May 26, 2004, through January 4, 2010, and 2007-2010 Saturn Aura vehicles manufactured April 24, 2006, through May 26, 2009. In the affected vehicles, increased resistance in the Body Control Module (BCM) connection may result in voltage fluctuations in the Brake Apply Sensor (BAS) circuit. These fluctuations can cause one or more of these conditions: the brake lights to illuminate without the brake pedal being pushed; the brake lights to not illuminate when the pedal is pushed; difficulty disengaging the cruise control; moving the gear shifter out of the 'PARK' position without pushing the brake; and disablement of crash avoidance features such as traction control, electronic stability control, and panic braking assist features.
Risk. Any of the above failure conditions increases the risk of a crash.
Fix. GM will notify owners, and dealers will attach the wiring harness to the BCM with a spacer, apply dielectric lubricant to both the BCM and harness connector and the BAS and harness connector, and will relearn the brake pedal home position, free of charge. The manufacturer distributed an Interim letter to customers on July 14, 2014. The recall began on August 18, 2014. Owners may contact General Motors customer service at 1-800-222-1020 (Chevrolet), 1-800-762-2737 (Pontiac), 1-800-553-6000 (Saturn). GM's number for this recall is 13036.
2008 Chevrolet Malibu recalls 5
Power Train:automatic Transmission:gear Position Indication (prndl)
What's wrong. General Motors (GM) is recalling certain model year 2007-2010 Saturn Aura and model year 2008-2010 Chevrolet Malibu and Pontiac G6 vehicles, equipped with a 4-speed automatic transmission. On these vehicles, the tabs on the transmission shift cable end may fracture and separate.
Risk. If the tabs were to fracture and separate, the shift lever and the actual position of the transmission gear may not match. The driver would be able to move the shifter to 'PARK' and remove the ignition key, but the transmission gear may not be in 'PARK.' The vehicle may not be able to be restarted and the vehicle could roll away after the driver has exited the vehicle, resulting in a possible crash without prior warning.
Fix. GM will notify owners, and dealers will install a retainer over the cable end or replace the shift cable as necessary. This service will be performed free of charge. Notification to owners began on on November 9, 2012. Owners were instructed to not bring their vehicles for repair until January 2013. Owners may contact General Motors at 1-800-521-7300.
Steering
What's wrong. Dorman Products, Inc. (Dorman) is recalling certain replacement intermediate steering shafts sold under the Dorman, OE Solutions, and Solutions brand names, part numbers 425-167, 2425167, and 7-3074, for installation on 2004-2012 Chevrolet Malibu, 2005-2010 Pontiac G6, and 2007-2009 Saturn Aura vehicles. The affected steering shafts may have a yoke that inadequately supports the u-joint bearing resulting in a premature failure.
Risk. A joint bearing that fails prematurely may cause separation of the u-joint resulting in a complete loss of steering control, increasing the risk of a crash.
Fix. Dorman will notify owners, and dealers will refund the purchase price or replace the steering shafts, free of charge. The recall began in September 2014. Owners may contact Dorman customer service at 1-800-523-2492.
Power Train:automatic Transmission
What's wrong. General Motors LLC (GM) notified the agency on April 29, 2014, that they are recalling 56,214 model year 2007 and 2008 Saturn Aura vehicles. On May 22, 2014, GM increased the recall to include an additional 1,074,899 model year 2004-2008 Chevrolet Malibu vehicles manufactured from May 16, 2003, through October 5, 2007, model year 2004-2007 Malibu Maxx vehicles manufactured from June 25, 2003, through April 5, 2007, and model year 2005-2008 Pontiac G6 vehicles manufactured from May 26, 2004, through September 28, 2007, and equipped with 4-speed transmissions. The total number vehicles being recalled is now 1,131,113.
Risk. If the transmission shift cable fractures while the vehicle is being driven, the transmission gear selection may not match the indicated gear and the vehicle may move in an unintended or unexpected direction, increasing the risk of a crash. Furthermore, when the driver goes to stop and park the vehicle, despite selecting the PARK position, the transmission may not be in PARK. If the vehicle is not in the "PARK" position there is a risk the vehicle will roll away as the driver and other occupants exit the vehicle or anytime thereafter. A vehicle rollaway increases the risk of injury to exiting occupants and bystanders.
Fix. GM will notify owners, and GM dealers will replace the shift cable assembly and mounting bracket, free of charge. The manufacturer has not yet provided a notification schedule. Owners may contact General Motors at 1-800-553-6000. GM's number for this recall is 14152.
Steering:electric Power Assist System
What's wrong. General Motors LLC (GM) is recalling certain model year 2004-2006 and 2008-2009 Chevrolet Malibu, 2004-2006 Malibu Maxx, 2009-2010 HHR (non-turbo), 2010 Cobalt, 2008-2009 Saturn Aura and 2004-2007 Ion, and 2005-2009 Pontiac G6. In the affected vehicles, there may be a sudden loss of electric power steering (EPS) assist that could occur at any time while driving.
Risk. If power steering assist is lost, greater driver effort would be required to steer the vehicle at low speeds, increasing the risk of a crash.
Fix. GM will notify owners, and dealers will perform one of four bulletins. Parts are not currently available. GM expects to send an interim notification around May 28, 2014. When parts are available, owners will be mailed a second letter to come in to have the applicable bulletin applied. Bulletin 14115 covers model year 2004-2007 Saturn Ion, 2009-2010 Chevrolet HHR and 2010 Chevrolet Cobalts. Dealers will replace the EPS motor. Bulletin 14116 covers model year 2004-2006 Chevrolet Malibu and Malibu Maxx, 2005-2006 Pontiac G6 and 2008-2009 Chevrolet Malibu, Pontiac G6 and Saturn Aura built from March 1, 2008, through June 27, 2008. Dealers will replace the torque sensor assembly. Bulletin 14117 covers model year 2008 Chevrolet Malibu, Pontiac G6 and Saturn Aura built from February 1, 2008, through February 28, 2008. Dealers will replace the torque sensor assembly and EPS motor controller unit. Bulletin 14118 covers model year 2008 Chevrolet Malibu, Pontiac G6 and Saturn Aura built from October 1, 2007, through January 31, 2008. Dealers will replace the EPS motor controller unit. The recall began on July 17, 2014. Owners may contact Chevrolet at 1-800-630-2438, Saturn at 1-800-553-6000, and Pontiac at 1-800-620-7668. GM's number for this recall is N140115. Note: GM bulletin number 14119 will be implemented for model year 2006-2008 and early production of 2009 Chevrolet HHR (non-turbo) and model year 2003 Saturn ION to provide EPS Motor replacement for the life of the vehicle.
Electrical System:wiring
What's wrong. General Motors LLC (GM) is recalling certain model year 2004-2012 Chevrolet Malibu vehicles manufactured May 16, 2003, through October 11, 2012, 2004-2007 Malibu Maxx vehicles manufactured June 25, 2003, through April 5, 2007, 2005-2010 Pontiac G6 vehicles manufactured May 26, 2004, through January 4, 2010, and 2007-2010 Saturn Aura vehicles manufactured April 24, 2006, through May 26, 2009. In the affected vehicles, increased resistance in the Body Control Module (BCM) connection may result in voltage fluctuations in the Brake Apply Sensor (BAS) circuit. These fluctuations can cause one or more of these conditions: the brake lights to illuminate without the brake pedal being pushed; the brake lights to not illuminate when the pedal is pushed; difficulty disengaging the cruise control; moving the gear shifter out of the 'PARK' position without pushing the brake; and disablement of crash avoidance features such as traction control, electronic stability control, and panic braking assist features.
Risk. Any of the above failure conditions increases the risk of a crash.
Fix. GM will notify owners, and dealers will attach the wiring harness to the BCM with a spacer, apply dielectric lubricant to both the BCM and harness connector and the BAS and harness connector, and will relearn the brake pedal home position, free of charge. The manufacturer distributed an Interim letter to customers on July 14, 2014. The recall began on August 18, 2014. Owners may contact General Motors customer service at 1-800-222-1020 (Chevrolet), 1-800-762-2737 (Pontiac), 1-800-553-6000 (Saturn). GM's number for this recall is 13036.
2007 Chevrolet Malibu recalls 6
Exterior Lighting
What's wrong. Sabersport is recalling 16,270 combination corner and bumper lamp assemblies of various part numbers sold for use as aftermarket equipment for various passenger vehicles. These headlamps fail to conform to the requirements of federal motor vehicle safety standard no. 108, "lamps, reflective devices, and associated equipment." these lamps do not contain the required amber side reflectors.
Risk. Decreased lighting visibility may result in a vehicle crash.
Fix. Sabersport will notify owners and offer a full refund for the noncompliant combination lamps. The safety recall began on may 11, 2009. Owners may contact sabersport at 1-909-598-7589.
Fuel System, Gasoline:delivery:fuel Pump
What's wrong. Ti automotive is recalling certain fuel pumps, part numbers tu456 and tu303, sold under various brand names as aftermarket and replacement equipment for the motor vehicles listed above. The defective fuel pump may seize, stopping the fuel flow to the engine creating a stalling condition.
Risk. A vehicle crash could occur should the engine stall while in use.
Fix. Ti automotive will notify owners of record and will replace any defective fuel pump with a new or reworked fuel pump free of charge. The safety recall began on february 22, 2011. Owners may contact ti automotive at 1-866-867-3759 or log on to www.recallresponse.com.
Steering
What's wrong. Dorman Products, Inc. (Dorman) is recalling certain replacement intermediate steering shafts sold under the Dorman, OE Solutions, and Solutions brand names, part numbers 425-167, 2425167, and 7-3074, for installation on 2004-2012 Chevrolet Malibu, 2005-2010 Pontiac G6, and 2007-2009 Saturn Aura vehicles. The affected steering shafts may have a yoke that inadequately supports the u-joint bearing resulting in a premature failure.
Risk. A joint bearing that fails prematurely may cause separation of the u-joint resulting in a complete loss of steering control, increasing the risk of a crash.
Fix. Dorman will notify owners, and dealers will refund the purchase price or replace the steering shafts, free of charge. The recall began in September 2014. Owners may contact Dorman customer service at 1-800-523-2492.
Power Train:automatic Transmission
What's wrong. General Motors LLC (GM) notified the agency on April 29, 2014, that they are recalling 56,214 model year 2007 and 2008 Saturn Aura vehicles. On May 22, 2014, GM increased the recall to include an additional 1,074,899 model year 2004-2008 Chevrolet Malibu vehicles manufactured from May 16, 2003, through October 5, 2007, model year 2004-2007 Malibu Maxx vehicles manufactured from June 25, 2003, through April 5, 2007, and model year 2005-2008 Pontiac G6 vehicles manufactured from May 26, 2004, through September 28, 2007, and equipped with 4-speed transmissions. The total number vehicles being recalled is now 1,131,113.
Risk. If the transmission shift cable fractures while the vehicle is being driven, the transmission gear selection may not match the indicated gear and the vehicle may move in an unintended or unexpected direction, increasing the risk of a crash. Furthermore, when the driver goes to stop and park the vehicle, despite selecting the PARK position, the transmission may not be in PARK. If the vehicle is not in the "PARK" position there is a risk the vehicle will roll away as the driver and other occupants exit the vehicle or anytime thereafter. A vehicle rollaway increases the risk of injury to exiting occupants and bystanders.
Fix. GM will notify owners, and GM dealers will replace the shift cable assembly and mounting bracket, free of charge. The manufacturer has not yet provided a notification schedule. Owners may contact General Motors at 1-800-553-6000. GM's number for this recall is 14152.
Steering:electric Power Assist System
What's wrong. General Motors LLC (GM) is recalling certain model year 2006-2007 Chevrolet Malibu and Malibu Maxx vehicles manufactured April 1, 2006, to June 30, 2006, and 2006-2007 Pontiac G6 vehicles manufactured April 18, 2006, to June 30, 2006. In the affected vehicles, there may be a sudden loss of electric power steering (EPS) assist that could occur at any time while driving.
Risk. If power steering assist is lost, greater driver effort would be required to steer the vehicle at low speeds, increasing the risk of a crash.
Fix. GM will notify owners, and dealers will replace the torque sensor assembly, free of charge. The recall began February 24, 2015. Owners may contact Chevrolet customer service at 1-800-222-1020 or Pontiac customer service at 1-800-762-2737. GM's number for this recall is 14772. Note: This is an expansion of recall 14V-153 to cover additional vehicles built between April 1, 2006 and June 30, 2006.
Electrical System:wiring
What's wrong. General Motors LLC (GM) is recalling certain model year 2004-2012 Chevrolet Malibu vehicles manufactured May 16, 2003, through October 11, 2012, 2004-2007 Malibu Maxx vehicles manufactured June 25, 2003, through April 5, 2007, 2005-2010 Pontiac G6 vehicles manufactured May 26, 2004, through January 4, 2010, and 2007-2010 Saturn Aura vehicles manufactured April 24, 2006, through May 26, 2009. In the affected vehicles, increased resistance in the Body Control Module (BCM) connection may result in voltage fluctuations in the Brake Apply Sensor (BAS) circuit. These fluctuations can cause one or more of these conditions: the brake lights to illuminate without the brake pedal being pushed; the brake lights to not illuminate when the pedal is pushed; difficulty disengaging the cruise control; moving the gear shifter out of the 'PARK' position without pushing the brake; and disablement of crash avoidance features such as traction control, electronic stability control, and panic braking assist features.
Risk. Any of the above failure conditions increases the risk of a crash.
Fix. GM will notify owners, and dealers will attach the wiring harness to the BCM with a spacer, apply dielectric lubricant to both the BCM and harness connector and the BAS and harness connector, and will relearn the brake pedal home position, free of charge. The manufacturer distributed an Interim letter to customers on July 14, 2014. The recall began on August 18, 2014. Owners may contact General Motors customer service at 1-800-222-1020 (Chevrolet), 1-800-762-2737 (Pontiac), 1-800-553-6000 (Saturn). GM's number for this recall is 13036.
2006 Chevrolet Malibu recalls 9
Air Bags:frontal
What's wrong. Certain vehicles originally built with cloth seats that were equipped with an automatic air bag passenger sensing system and later reupholstered with aftermarket leather seat cover kits are involved. Testing has indicated that the aftermarket leather seat covers can cause the passenger sensing system to malfunction.
Risk. If the passenger sensing system malfunctions, the front air bag on the passenger side may be disabled when it should be enabled, or enabled when it should be disabled. In either case, in the event of a crash that requires air bag deployment, a front passenger's level of injury may be increased.
Fix. Because a replacement leather seat cover that is compatible with the passenger sensing system is not available, general motors (gm) will repurchase these vehicles in accordance with the terms stated in gm's letter to owners. The recall began on november 6, 2006. Owners should contact gm at 1-877-477-1022 to begin the process of repurchasing their vehicle.
Equipment:other:labels
What's wrong. Certain vehicles fail to conform to the requirements of federal motor vehicle safety standard no. 110, "tire selection and rims." the tire label table specified the 15 inch spare for the front disc/rear drum brake system and it should specify a 16 inch spare tire size.
Risk. A 15" diameter replacement spare tire can not be installed on the front axle due to a fit interference with the brake caliper.
Fix. Owners will be mailed a corrected label with installation instructions or the customers could have their dealers to install the label for them. The recall began on november 29, 2005. Owners may contact chevrolet at 1-800-630-2438.
Exterior Lighting
What's wrong. Sabersport is recalling 16,270 combination corner and bumper lamp assemblies of various part numbers sold for use as aftermarket equipment for various passenger vehicles. These headlamps fail to conform to the requirements of federal motor vehicle safety standard no. 108, "lamps, reflective devices, and associated equipment." these lamps do not contain the required amber side reflectors.
Risk. Decreased lighting visibility may result in a vehicle crash.
Fix. Sabersport will notify owners and offer a full refund for the noncompliant combination lamps. The safety recall began on may 11, 2009. Owners may contact sabersport at 1-909-598-7589.
Fuel System, Gasoline:delivery:fuel Pump
What's wrong. Ti automotive is recalling certain fuel pumps, part numbers tu456 and tu303, sold under various brand names as aftermarket and replacement equipment for the motor vehicles listed above. The defective fuel pump may seize, stopping the fuel flow to the engine creating a stalling condition.
Risk. A vehicle crash could occur should the engine stall while in use.
Fix. Ti automotive will notify owners of record and will replace any defective fuel pump with a new or reworked fuel pump free of charge. The safety recall began on february 22, 2011. Owners may contact ti automotive at 1-866-867-3759 or log on to www.recallresponse.com.
Steering
What's wrong. Dorman Products, Inc. (Dorman) is recalling certain replacement intermediate steering shafts sold under the Dorman, OE Solutions, and Solutions brand names, part numbers 425-167, 2425167, and 7-3074, for installation on 2004-2012 Chevrolet Malibu, 2005-2010 Pontiac G6, and 2007-2009 Saturn Aura vehicles. The affected steering shafts may have a yoke that inadequately supports the u-joint bearing resulting in a premature failure.
Risk. A joint bearing that fails prematurely may cause separation of the u-joint resulting in a complete loss of steering control, increasing the risk of a crash.
Fix. Dorman will notify owners, and dealers will refund the purchase price or replace the steering shafts, free of charge. The recall began in September 2014. Owners may contact Dorman customer service at 1-800-523-2492.
Power Train:automatic Transmission
What's wrong. General Motors LLC (GM) notified the agency on April 29, 2014, that they are recalling 56,214 model year 2007 and 2008 Saturn Aura vehicles. On May 22, 2014, GM increased the recall to include an additional 1,074,899 model year 2004-2008 Chevrolet Malibu vehicles manufactured from May 16, 2003, through October 5, 2007, model year 2004-2007 Malibu Maxx vehicles manufactured from June 25, 2003, through April 5, 2007, and model year 2005-2008 Pontiac G6 vehicles manufactured from May 26, 2004, through September 28, 2007, and equipped with 4-speed transmissions. The total number vehicles being recalled is now 1,131,113.
Risk. If the transmission shift cable fractures while the vehicle is being driven, the transmission gear selection may not match the indicated gear and the vehicle may move in an unintended or unexpected direction, increasing the risk of a crash. Furthermore, when the driver goes to stop and park the vehicle, despite selecting the PARK position, the transmission may not be in PARK. If the vehicle is not in the "PARK" position there is a risk the vehicle will roll away as the driver and other occupants exit the vehicle or anytime thereafter. A vehicle rollaway increases the risk of injury to exiting occupants and bystanders.
Fix. GM will notify owners, and GM dealers will replace the shift cable assembly and mounting bracket, free of charge. The manufacturer has not yet provided a notification schedule. Owners may contact General Motors at 1-800-553-6000. GM's number for this recall is 14152.
Steering:electric Power Assist System
What's wrong. General Motors LLC (GM) is recalling certain model year 2006-2007 Chevrolet Malibu and Malibu Maxx vehicles manufactured April 1, 2006, to June 30, 2006, and 2006-2007 Pontiac G6 vehicles manufactured April 18, 2006, to June 30, 2006. In the affected vehicles, there may be a sudden loss of electric power steering (EPS) assist that could occur at any time while driving.
Risk. If power steering assist is lost, greater driver effort would be required to steer the vehicle at low speeds, increasing the risk of a crash.
Fix. GM will notify owners, and dealers will replace the torque sensor assembly, free of charge. The recall began February 24, 2015. Owners may contact Chevrolet customer service at 1-800-222-1020 or Pontiac customer service at 1-800-762-2737. GM's number for this recall is 14772. Note: This is an expansion of recall 14V-153 to cover additional vehicles built between April 1, 2006 and June 30, 2006.
Steering:electric Power Assist System
What's wrong. General Motors LLC (GM) is recalling certain model year 2004-2006 and 2008-2009 Chevrolet Malibu, 2004-2006 Malibu Maxx, 2009-2010 HHR (non-turbo), 2010 Cobalt, 2008-2009 Saturn Aura and 2004-2007 Ion, and 2005-2009 Pontiac G6. In the affected vehicles, there may be a sudden loss of electric power steering (EPS) assist that could occur at any time while driving.
Risk. If power steering assist is lost, greater driver effort would be required to steer the vehicle at low speeds, increasing the risk of a crash.
Fix. GM will notify owners, and dealers will perform one of four bulletins. Parts are not currently available. GM expects to send an interim notification around May 28, 2014. When parts are available, owners will be mailed a second letter to come in to have the applicable bulletin applied. Bulletin 14115 covers model year 2004-2007 Saturn Ion, 2009-2010 Chevrolet HHR and 2010 Chevrolet Cobalts. Dealers will replace the EPS motor. Bulletin 14116 covers model year 2004-2006 Chevrolet Malibu and Malibu Maxx, 2005-2006 Pontiac G6 and 2008-2009 Chevrolet Malibu, Pontiac G6 and Saturn Aura built from March 1, 2008, through June 27, 2008. Dealers will replace the torque sensor assembly. Bulletin 14117 covers model year 2008 Chevrolet Malibu, Pontiac G6 and Saturn Aura built from February 1, 2008, through February 28, 2008. Dealers will replace the torque sensor assembly and EPS motor controller unit. Bulletin 14118 covers model year 2008 Chevrolet Malibu, Pontiac G6 and Saturn Aura built from October 1, 2007, through January 31, 2008. Dealers will replace the EPS motor controller unit. The recall began on July 17, 2014. Owners may contact Chevrolet at 1-800-630-2438, Saturn at 1-800-553-6000, and Pontiac at 1-800-620-7668. GM's number for this recall is N140115. Note: GM bulletin number 14119 will be implemented for model year 2006-2008 and early production of 2009 Chevrolet HHR (non-turbo) and model year 2003 Saturn ION to provide EPS Motor replacement for the life of the vehicle.
Electrical System:wiring
What's wrong. General Motors LLC (GM) is recalling certain model year 2004-2012 Chevrolet Malibu vehicles manufactured May 16, 2003, through October 11, 2012, 2004-2007 Malibu Maxx vehicles manufactured June 25, 2003, through April 5, 2007, 2005-2010 Pontiac G6 vehicles manufactured May 26, 2004, through January 4, 2010, and 2007-2010 Saturn Aura vehicles manufactured April 24, 2006, through May 26, 2009. In the affected vehicles, increased resistance in the Body Control Module (BCM) connection may result in voltage fluctuations in the Brake Apply Sensor (BAS) circuit. These fluctuations can cause one or more of these conditions: the brake lights to illuminate without the brake pedal being pushed; the brake lights to not illuminate when the pedal is pushed; difficulty disengaging the cruise control; moving the gear shifter out of the 'PARK' position without pushing the brake; and disablement of crash avoidance features such as traction control, electronic stability control, and panic braking assist features.
Risk. Any of the above failure conditions increases the risk of a crash.
Fix. GM will notify owners, and dealers will attach the wiring harness to the BCM with a spacer, apply dielectric lubricant to both the BCM and harness connector and the BAS and harness connector, and will relearn the brake pedal home position, free of charge. The manufacturer distributed an Interim letter to customers on July 14, 2014. The recall began on August 18, 2014. Owners may contact General Motors customer service at 1-800-222-1020 (Chevrolet), 1-800-762-2737 (Pontiac), 1-800-553-6000 (Saturn). GM's number for this recall is 13036.
2005 Chevrolet Malibu recalls 6
Exterior Lighting
What's wrong. Sabersport is recalling 16,270 combination corner and bumper lamp assemblies of various part numbers sold for use as aftermarket equipment for various passenger vehicles. These headlamps fail to conform to the requirements of federal motor vehicle safety standard no. 108, "lamps, reflective devices, and associated equipment." these lamps do not contain the required amber side reflectors.
Risk. Decreased lighting visibility may result in a vehicle crash.
Fix. Sabersport will notify owners and offer a full refund for the noncompliant combination lamps. The safety recall began on may 11, 2009. Owners may contact sabersport at 1-909-598-7589.
Fuel System, Gasoline:delivery:fuel Pump
What's wrong. Ti automotive is recalling certain fuel pumps, part numbers tu456 and tu303, sold under various brand names as aftermarket and replacement equipment for the motor vehicles listed above. The defective fuel pump may seize, stopping the fuel flow to the engine creating a stalling condition.
Risk. A vehicle crash could occur should the engine stall while in use.
Fix. Ti automotive will notify owners of record and will replace any defective fuel pump with a new or reworked fuel pump free of charge. The safety recall began on february 22, 2011. Owners may contact ti automotive at 1-866-867-3759 or log on to www.recallresponse.com.
Steering
What's wrong. Dorman Products, Inc. (Dorman) is recalling certain replacement intermediate steering shafts sold under the Dorman, OE Solutions, and Solutions brand names, part numbers 425-167, 2425167, and 7-3074, for installation on 2004-2012 Chevrolet Malibu, 2005-2010 Pontiac G6, and 2007-2009 Saturn Aura vehicles. The affected steering shafts may have a yoke that inadequately supports the u-joint bearing resulting in a premature failure.
Risk. A joint bearing that fails prematurely may cause separation of the u-joint resulting in a complete loss of steering control, increasing the risk of a crash.
Fix. Dorman will notify owners, and dealers will refund the purchase price or replace the steering shafts, free of charge. The recall began in September 2014. Owners may contact Dorman customer service at 1-800-523-2492.
Power Train:automatic Transmission
What's wrong. General Motors LLC (GM) notified the agency on April 29, 2014, that they are recalling 56,214 model year 2007 and 2008 Saturn Aura vehicles. On May 22, 2014, GM increased the recall to include an additional 1,074,899 model year 2004-2008 Chevrolet Malibu vehicles manufactured from May 16, 2003, through October 5, 2007, model year 2004-2007 Malibu Maxx vehicles manufactured from June 25, 2003, through April 5, 2007, and model year 2005-2008 Pontiac G6 vehicles manufactured from May 26, 2004, through September 28, 2007, and equipped with 4-speed transmissions. The total number vehicles being recalled is now 1,131,113.
Risk. If the transmission shift cable fractures while the vehicle is being driven, the transmission gear selection may not match the indicated gear and the vehicle may move in an unintended or unexpected direction, increasing the risk of a crash. Furthermore, when the driver goes to stop and park the vehicle, despite selecting the PARK position, the transmission may not be in PARK. If the vehicle is not in the "PARK" position there is a risk the vehicle will roll away as the driver and other occupants exit the vehicle or anytime thereafter. A vehicle rollaway increases the risk of injury to exiting occupants and bystanders.
Fix. GM will notify owners, and GM dealers will replace the shift cable assembly and mounting bracket, free of charge. The manufacturer has not yet provided a notification schedule. Owners may contact General Motors at 1-800-553-6000. GM's number for this recall is 14152.
Steering:electric Power Assist System
What's wrong. General Motors LLC (GM) is recalling certain model year 2004-2006 and 2008-2009 Chevrolet Malibu, 2004-2006 Malibu Maxx, 2009-2010 HHR (non-turbo), 2010 Cobalt, 2008-2009 Saturn Aura and 2004-2007 Ion, and 2005-2009 Pontiac G6. In the affected vehicles, there may be a sudden loss of electric power steering (EPS) assist that could occur at any time while driving.
Risk. If power steering assist is lost, greater driver effort would be required to steer the vehicle at low speeds, increasing the risk of a crash.
Fix. GM will notify owners, and dealers will perform one of four bulletins. Parts are not currently available. GM expects to send an interim notification around May 28, 2014. When parts are available, owners will be mailed a second letter to come in to have the applicable bulletin applied. Bulletin 14115 covers model year 2004-2007 Saturn Ion, 2009-2010 Chevrolet HHR and 2010 Chevrolet Cobalts. Dealers will replace the EPS motor. Bulletin 14116 covers model year 2004-2006 Chevrolet Malibu and Malibu Maxx, 2005-2006 Pontiac G6 and 2008-2009 Chevrolet Malibu, Pontiac G6 and Saturn Aura built from March 1, 2008, through June 27, 2008. Dealers will replace the torque sensor assembly. Bulletin 14117 covers model year 2008 Chevrolet Malibu, Pontiac G6 and Saturn Aura built from February 1, 2008, through February 28, 2008. Dealers will replace the torque sensor assembly and EPS motor controller unit. Bulletin 14118 covers model year 2008 Chevrolet Malibu, Pontiac G6 and Saturn Aura built from October 1, 2007, through January 31, 2008. Dealers will replace the EPS motor controller unit. The recall began on July 17, 2014. Owners may contact Chevrolet at 1-800-630-2438, Saturn at 1-800-553-6000, and Pontiac at 1-800-620-7668. GM's number for this recall is N140115. Note: GM bulletin number 14119 will be implemented for model year 2006-2008 and early production of 2009 Chevrolet HHR (non-turbo) and model year 2003 Saturn ION to provide EPS Motor replacement for the life of the vehicle.
Electrical System:wiring
What's wrong. General Motors LLC (GM) is recalling certain model year 2004-2012 Chevrolet Malibu vehicles manufactured May 16, 2003, through October 11, 2012, 2004-2007 Malibu Maxx vehicles manufactured June 25, 2003, through April 5, 2007, 2005-2010 Pontiac G6 vehicles manufactured May 26, 2004, through January 4, 2010, and 2007-2010 Saturn Aura vehicles manufactured April 24, 2006, through May 26, 2009. In the affected vehicles, increased resistance in the Body Control Module (BCM) connection may result in voltage fluctuations in the Brake Apply Sensor (BAS) circuit. These fluctuations can cause one or more of these conditions: the brake lights to illuminate without the brake pedal being pushed; the brake lights to not illuminate when the pedal is pushed; difficulty disengaging the cruise control; moving the gear shifter out of the 'PARK' position without pushing the brake; and disablement of crash avoidance features such as traction control, electronic stability control, and panic braking assist features.
Risk. Any of the above failure conditions increases the risk of a crash.
Fix. GM will notify owners, and dealers will attach the wiring harness to the BCM with a spacer, apply dielectric lubricant to both the BCM and harness connector and the BAS and harness connector, and will relearn the brake pedal home position, free of charge. The manufacturer distributed an Interim letter to customers on July 14, 2014. The recall began on August 18, 2014. Owners may contact General Motors customer service at 1-800-222-1020 (Chevrolet), 1-800-762-2737 (Pontiac), 1-800-553-6000 (Saturn). GM's number for this recall is 13036.
2004 Chevrolet Malibu recalls 9
Equipment:other:labels
What's wrong. Certain passenger vehicles fail to comply with the requirements of federal motor vehicle safety standard (fmvss) no. 208, "occupant crash protection." some of these vehicles that were not equipped with an advanced occupant restraint system (aors) have driver and passenger side sun visors with aors labels. The aors labels do not include statements and the illustration required by fmvss no. 208 for vehicles without aors.
Fix. Owners will be sent replacement labels with instructions on how to install them. Owner notification began on april 21, 2004. Owners should contact chevrolet at 1-800-630-2438.
Seat Belts:front:anchorage
What's wrong. On certain passenger vehicles, analysis of an a side impact crash test conducted by the nhtsa;s new car assessment program (ncap) indicated that the outboard anchorage of the driver's seat belt could disconnect because of contact between the seat trim and the anchorage connector when the seat was adjusted to its lowest position.
Risk. If this occurred in a crash, the driver could receive greater injuries.
Fix. Dealers will insert a retainer on both the driver's and passenger's belt anchorages. Owner notification began on june 16, 2004. Owners should contact chevrolet at 1-800-630-2438.
Service Brakes, Hydraulic:antilock/traction Control/electronic Limited Slip:control Unit/module
What's wrong. Some of these passenger vehicles have an electronic control unit (ecu) that may calculate a higher than actual vehicle speed because of an erratic rear-wheel speed sensor signal, and cause abs activation where it is not needed or needed abs activation to be extended during braking as the vehicle speed drops to about 3 mph.
Risk. Unexpected abs activiation could increase stopping distance up to about 11 feet dpending on the grade of the road, increasing the risk of a crash.
Fix. Dealers will reprogram the abs controller. Owner notification began on june 16, 2004. Owners should contact chevrolet at 1-800-630-2438.
Exterior Lighting
What's wrong. Sabersport is recalling 16,270 combination corner and bumper lamp assemblies of various part numbers sold for use as aftermarket equipment for various passenger vehicles. These headlamps fail to conform to the requirements of federal motor vehicle safety standard no. 108, "lamps, reflective devices, and associated equipment." these lamps do not contain the required amber side reflectors.
Risk. Decreased lighting visibility may result in a vehicle crash.
Fix. Sabersport will notify owners and offer a full refund for the noncompliant combination lamps. The safety recall began on may 11, 2009. Owners may contact sabersport at 1-909-598-7589.
Fuel System, Gasoline:delivery:fuel Pump
What's wrong. Ti automotive is recalling certain fuel pumps, part numbers tu456 and tu303, sold under various brand names as aftermarket and replacement equipment for the motor vehicles listed above. The defective fuel pump may seize, stopping the fuel flow to the engine creating a stalling condition.
Risk. A vehicle crash could occur should the engine stall while in use.
Fix. Ti automotive will notify owners of record and will replace any defective fuel pump with a new or reworked fuel pump free of charge. The safety recall began on february 22, 2011. Owners may contact ti automotive at 1-866-867-3759 or log on to www.recallresponse.com.
Steering
What's wrong. Dorman Products, Inc. (Dorman) is recalling certain replacement intermediate steering shafts sold under the Dorman, OE Solutions, and Solutions brand names, part numbers 425-167, 2425167, and 7-3074, for installation on 2004-2012 Chevrolet Malibu, 2005-2010 Pontiac G6, and 2007-2009 Saturn Aura vehicles. The affected steering shafts may have a yoke that inadequately supports the u-joint bearing resulting in a premature failure.
Risk. A joint bearing that fails prematurely may cause separation of the u-joint resulting in a complete loss of steering control, increasing the risk of a crash.
Fix. Dorman will notify owners, and dealers will refund the purchase price or replace the steering shafts, free of charge. The recall began in September 2014. Owners may contact Dorman customer service at 1-800-523-2492.
Power Train:automatic Transmission
What's wrong. General Motors LLC (GM) notified the agency on April 29, 2014, that they are recalling 56,214 model year 2007 and 2008 Saturn Aura vehicles. On May 22, 2014, GM increased the recall to include an additional 1,074,899 model year 2004-2008 Chevrolet Malibu vehicles manufactured from May 16, 2003, through October 5, 2007, model year 2004-2007 Malibu Maxx vehicles manufactured from June 25, 2003, through April 5, 2007, and model year 2005-2008 Pontiac G6 vehicles manufactured from May 26, 2004, through September 28, 2007, and equipped with 4-speed transmissions. The total number vehicles being recalled is now 1,131,113.
Risk. If the transmission shift cable fractures while the vehicle is being driven, the transmission gear selection may not match the indicated gear and the vehicle may move in an unintended or unexpected direction, increasing the risk of a crash. Furthermore, when the driver goes to stop and park the vehicle, despite selecting the PARK position, the transmission may not be in PARK. If the vehicle is not in the "PARK" position there is a risk the vehicle will roll away as the driver and other occupants exit the vehicle or anytime thereafter. A vehicle rollaway increases the risk of injury to exiting occupants and bystanders.
Fix. GM will notify owners, and GM dealers will replace the shift cable assembly and mounting bracket, free of charge. The manufacturer has not yet provided a notification schedule. Owners may contact General Motors at 1-800-553-6000. GM's number for this recall is 14152.
Steering:electric Power Assist System
What's wrong. General Motors LLC (GM) is recalling certain model year 2004-2006 and 2008-2009 Chevrolet Malibu, 2004-2006 Malibu Maxx, 2009-2010 HHR (non-turbo), 2010 Cobalt, 2008-2009 Saturn Aura and 2004-2007 Ion, and 2005-2009 Pontiac G6. In the affected vehicles, there may be a sudden loss of electric power steering (EPS) assist that could occur at any time while driving.
Risk. If power steering assist is lost, greater driver effort would be required to steer the vehicle at low speeds, increasing the risk of a crash.
Fix. GM will notify owners, and dealers will perform one of four bulletins. Parts are not currently available. GM expects to send an interim notification around May 28, 2014. When parts are available, owners will be mailed a second letter to come in to have the applicable bulletin applied. Bulletin 14115 covers model year 2004-2007 Saturn Ion, 2009-2010 Chevrolet HHR and 2010 Chevrolet Cobalts. Dealers will replace the EPS motor. Bulletin 14116 covers model year 2004-2006 Chevrolet Malibu and Malibu Maxx, 2005-2006 Pontiac G6 and 2008-2009 Chevrolet Malibu, Pontiac G6 and Saturn Aura built from March 1, 2008, through June 27, 2008. Dealers will replace the torque sensor assembly. Bulletin 14117 covers model year 2008 Chevrolet Malibu, Pontiac G6 and Saturn Aura built from February 1, 2008, through February 28, 2008. Dealers will replace the torque sensor assembly and EPS motor controller unit. Bulletin 14118 covers model year 2008 Chevrolet Malibu, Pontiac G6 and Saturn Aura built from October 1, 2007, through January 31, 2008. Dealers will replace the EPS motor controller unit. The recall began on July 17, 2014. Owners may contact Chevrolet at 1-800-630-2438, Saturn at 1-800-553-6000, and Pontiac at 1-800-620-7668. GM's number for this recall is N140115. Note: GM bulletin number 14119 will be implemented for model year 2006-2008 and early production of 2009 Chevrolet HHR (non-turbo) and model year 2003 Saturn ION to provide EPS Motor replacement for the life of the vehicle.
Electrical System:wiring
What's wrong. General Motors LLC (GM) is recalling certain model year 2004-2012 Chevrolet Malibu vehicles manufactured May 16, 2003, through October 11, 2012, 2004-2007 Malibu Maxx vehicles manufactured June 25, 2003, through April 5, 2007, 2005-2010 Pontiac G6 vehicles manufactured May 26, 2004, through January 4, 2010, and 2007-2010 Saturn Aura vehicles manufactured April 24, 2006, through May 26, 2009. In the affected vehicles, increased resistance in the Body Control Module (BCM) connection may result in voltage fluctuations in the Brake Apply Sensor (BAS) circuit. These fluctuations can cause one or more of these conditions: the brake lights to illuminate without the brake pedal being pushed; the brake lights to not illuminate when the pedal is pushed; difficulty disengaging the cruise control; moving the gear shifter out of the 'PARK' position without pushing the brake; and disablement of crash avoidance features such as traction control, electronic stability control, and panic braking assist features.
Risk. Any of the above failure conditions increases the risk of a crash.
Fix. GM will notify owners, and dealers will attach the wiring harness to the BCM with a spacer, apply dielectric lubricant to both the BCM and harness connector and the BAS and harness connector, and will relearn the brake pedal home position, free of charge. The manufacturer distributed an Interim letter to customers on July 14, 2014. The recall began on August 18, 2014. Owners may contact General Motors customer service at 1-800-222-1020 (Chevrolet), 1-800-762-2737 (Pontiac), 1-800-553-6000 (Saturn). GM's number for this recall is 13036.
2003 Chevrolet Malibu recalls 3
Fuel System, Other:storage:tank Assembly:pressure Relief Devices
What's wrong. Certain delphi fuel pressure regulators, p/nos. Fp10020-11b1, fp10026-11b1, and fp10027-11b1, sold after january 9, 2007, as aftermarket equipment for various passenger vehicles listed above. The universal pressure regulators (upr) were produced without an o'ring and retainer.
Risk. Fuel may leak, possibly resulting in a fire.
Fix. Delphi will notify owners and replace the upr free of charge. The recall began on april 23, 2007. Owners can contact delphi at 877-411-8770.
Vehicle Speed Control:accelerator Pedal
What's wrong. Certain passenger vehicles fail to comply with the requirements of federal motor vehicle safety standard no. 124, 'accelerator control systems.' in hot ambient conditions, the accelerator pedal arm may stick at the attachment to the bracket and not return to the engine idle position when the operator lifts his foot from the accelerator pedal.
Risk. Failure to return to idle could result in a vehicle crash.
Fix. Dealers will inspect the accelerator pedal arm and replace the accelerator and brake pedal assembly with a new assembly, if necessary. The recall began on december 20, 2004. Owners should contact chevrolet at 1-800-630-2438, pontiac at 1-800-620-7668, or oldsmobile at 1-800-630-6537.
Electrical System:ignition
What's wrong. This defect can affect the safe operation of the airbag system. Until this recall is performed, customers should remove all items from their key rings, leaving only the ignition key. The key fob (if applicable), should also be removed from the key ring. General Motors LLC (GM) notified the agency on July 3, 2014, that they are recalling 5,877,718 model year 2000-2005 Chevrolet Impala and Monte Carlo, 1997-2003 Chevrolet Malibu, 2004-2005 Malibu Classic, 1999-2004 Oldsmobile Alero, 1998-2002 Oldsmobile Intrigue, 1999-2005 Pontiac Grand Am and 2004-2008 Pontiac Grand Prix vehicles. In these models, the weight on the key ring and/or road conditions or some other jarring event may cause the ignition switch to move out of the run position, turning off the engine.
Risk. If the key is not in the run position, the air bags may not deploy if the vehicle is involved in a crash, increasing the risk of injury.
Fix. GM will notify owners, and dealers will install two key rings and an insert in the key slot or a cover over the key head on all ignition keys, free of charge. The recall began on September 9, 2014. GM's number for this recall is 14350.
2002 Chevrolet Malibu recalls 4
Exterior Lighting:headlights
What's wrong. Certain passenger vehicles fail to conform to federal motor vehicle safety standard no. 108, "lamps, reflective devices, and associated equipment." some of these vehicles were produced with a left low-beam headlamp that does not meet the photometric performance requirements of the standard.
Risk. Light intensities below the minimum intensity requirements cause reduction in visibility down the road for the driver of the vehicle and intensities above the maximum intensity requirements cause increase in glare for drivers ahead of, or approaching, the vehicle.
Fix. Dealers will inspect the left low-beam headlamp and replace it if it does not meet requirements. Owner notification began may 23, 2002. Owners who take their vehicles to an authorized dealer on an agreed upon service date and do not receive the free remedy within a reasonable time should contact chevrolet at 1-800-222-1020.
Fuel System, Other:storage:tank Assembly:pressure Relief Devices
What's wrong. Certain delphi fuel pressure regulators, p/nos. Fp10020-11b1, fp10026-11b1, and fp10027-11b1, sold after january 9, 2007, as aftermarket equipment for various passenger vehicles listed above. The universal pressure regulators (upr) were produced without an o'ring and retainer.
Risk. Fuel may leak, possibly resulting in a fire.
Fix. Delphi will notify owners and replace the upr free of charge. The recall began on april 23, 2007. Owners can contact delphi at 877-411-8770.
Exterior Lighting
What's wrong. Sabersport is recalling 16,270 combination corner and bumper lamp assemblies of various part numbers sold for use as aftermarket equipment for various passenger vehicles. These headlamps fail to conform to the requirements of federal motor vehicle safety standard no. 108, "lamps, reflective devices, and associated equipment." these lamps do not contain the required amber side reflectors.
Risk. Decreased lighting visibility may result in a vehicle crash.
Fix. Sabersport will notify owners and offer a full refund for the noncompliant combination lamps. The safety recall began on may 11, 2009. Owners may contact sabersport at 1-909-598-7589.
Electrical System:ignition
What's wrong. This defect can affect the safe operation of the airbag system. Until this recall is performed, customers should remove all items from their key rings, leaving only the ignition key. The key fob (if applicable), should also be removed from the key ring. General Motors LLC (GM) notified the agency on July 3, 2014, that they are recalling 5,877,718 model year 2000-2005 Chevrolet Impala and Monte Carlo, 1997-2003 Chevrolet Malibu, 2004-2005 Malibu Classic, 1999-2004 Oldsmobile Alero, 1998-2002 Oldsmobile Intrigue, 1999-2005 Pontiac Grand Am and 2004-2008 Pontiac Grand Prix vehicles. In these models, the weight on the key ring and/or road conditions or some other jarring event may cause the ignition switch to move out of the run position, turning off the engine.
Risk. If the key is not in the run position, the air bags may not deploy if the vehicle is involved in a crash, increasing the risk of injury.
Fix. GM will notify owners, and dealers will install two key rings and an insert in the key slot or a cover over the key head on all ignition keys, free of charge. The recall began on September 9, 2014. GM's number for this recall is 14350.
2001 Chevrolet Malibu recalls 4
Exterior Lighting:hazard Flashing Warning Lights:switch
What's wrong. Certain passenger vehicles have hazard warning switches that may experience solder joint cracking caused by rapid temperature transitions and the soldering process. If solder joint cracking occurs and results in an open circuit, the turn signals/hazard lamps become intermittent or inoperative.
Risk. When the turn signals are inoperative, the driver cannot use them to signal intent to turn that could result in a crash.
Fix. Dealers will replace the hazard warning switch. Owner notification began on february 5, 2004. Owners should contact chevrolet at 1-800-630-2438, pontiac at 1-800-620-7668, or oldsmobile at 1-800-630-6537.
Fuel System, Other:storage:tank Assembly:pressure Relief Devices
What's wrong. Certain delphi fuel pressure regulators, p/nos. Fp10020-11b1, fp10026-11b1, and fp10027-11b1, sold after january 9, 2007, as aftermarket equipment for various passenger vehicles listed above. The universal pressure regulators (upr) were produced without an o'ring and retainer.
Risk. Fuel may leak, possibly resulting in a fire.
Fix. Delphi will notify owners and replace the upr free of charge. The recall began on april 23, 2007. Owners can contact delphi at 877-411-8770.
Exterior Lighting
What's wrong. Sabersport is recalling 16,270 combination corner and bumper lamp assemblies of various part numbers sold for use as aftermarket equipment for various passenger vehicles. These headlamps fail to conform to the requirements of federal motor vehicle safety standard no. 108, "lamps, reflective devices, and associated equipment." these lamps do not contain the required amber side reflectors.
Risk. Decreased lighting visibility may result in a vehicle crash.
Fix. Sabersport will notify owners and offer a full refund for the noncompliant combination lamps. The safety recall began on may 11, 2009. Owners may contact sabersport at 1-909-598-7589.
Electrical System:ignition
What's wrong. This defect can affect the safe operation of the airbag system. Until this recall is performed, customers should remove all items from their key rings, leaving only the ignition key. The key fob (if applicable), should also be removed from the key ring. General Motors LLC (GM) notified the agency on July 3, 2014, that they are recalling 5,877,718 model year 2000-2005 Chevrolet Impala and Monte Carlo, 1997-2003 Chevrolet Malibu, 2004-2005 Malibu Classic, 1999-2004 Oldsmobile Alero, 1998-2002 Oldsmobile Intrigue, 1999-2005 Pontiac Grand Am and 2004-2008 Pontiac Grand Prix vehicles. In these models, the weight on the key ring and/or road conditions or some other jarring event may cause the ignition switch to move out of the run position, turning off the engine.
Risk. If the key is not in the run position, the air bags may not deploy if the vehicle is involved in a crash, increasing the risk of injury.
Fix. GM will notify owners, and dealers will install two key rings and an insert in the key slot or a cover over the key head on all ignition keys, free of charge. The recall began on September 9, 2014. GM's number for this recall is 14350.
2000 Chevrolet Malibu recalls 5
Fuel System, Gasoline:storage:tank Assembly:filler Pipe And Cap
What's wrong. Certain passenger vehicles fail to comply with requirements of fmvss no. 301, "fuel system integrity." the fuel fill fitting is not properly secured to the fuel tank. In that condition, fuel leakage would exceed the permissible amount in an fmvss test. Fuel leaks may occur, particularly after refueling or when the tank is more than half full.
Risk. If an ignition source were present, a fire could occur.
Fix. Dealers will inspect the fuel tank and replace it if necessary.
Exterior Lighting:hazard Flashing Warning Lights:switch
What's wrong. Certain passenger vehicles have hazard warning switches that may experience solder joint cracking caused by rapid temperature transitions and the soldering process. If solder joint cracking occurs and results in an open circuit, the turn signals/hazard lamps become intermittent or inoperative.
Risk. When the turn signals are inoperative, the driver cannot use them to signal intent to turn that could result in a crash.
Fix. Dealers will replace the hazard warning switch. Owner notification began on february 5, 2004. Owners should contact chevrolet at 1-800-630-2438, pontiac at 1-800-620-7668, or oldsmobile at 1-800-630-6537.
Fuel System, Other:storage:tank Assembly:pressure Relief Devices
What's wrong. Certain delphi fuel pressure regulators, p/nos. Fp10020-11b1, fp10026-11b1, and fp10027-11b1, sold after january 9, 2007, as aftermarket equipment for various passenger vehicles listed above. The universal pressure regulators (upr) were produced without an o'ring and retainer.
Risk. Fuel may leak, possibly resulting in a fire.
Fix. Delphi will notify owners and replace the upr free of charge. The recall began on april 23, 2007. Owners can contact delphi at 877-411-8770.
Exterior Lighting
What's wrong. Sabersport is recalling 16,270 combination corner and bumper lamp assemblies of various part numbers sold for use as aftermarket equipment for various passenger vehicles. These headlamps fail to conform to the requirements of federal motor vehicle safety standard no. 108, "lamps, reflective devices, and associated equipment." these lamps do not contain the required amber side reflectors.
Risk. Decreased lighting visibility may result in a vehicle crash.
Fix. Sabersport will notify owners and offer a full refund for the noncompliant combination lamps. The safety recall began on may 11, 2009. Owners may contact sabersport at 1-909-598-7589.
Electrical System:ignition
What's wrong. This defect can affect the safe operation of the airbag system. Until this recall is performed, customers should remove all items from their key rings, leaving only the ignition key. The key fob (if applicable), should also be removed from the key ring. General Motors LLC (GM) notified the agency on July 3, 2014, that they are recalling 5,877,718 model year 2000-2005 Chevrolet Impala and Monte Carlo, 1997-2003 Chevrolet Malibu, 2004-2005 Malibu Classic, 1999-2004 Oldsmobile Alero, 1998-2002 Oldsmobile Intrigue, 1999-2005 Pontiac Grand Am and 2004-2008 Pontiac Grand Prix vehicles. In these models, the weight on the key ring and/or road conditions or some other jarring event may cause the ignition switch to move out of the run position, turning off the engine.
Risk. If the key is not in the run position, the air bags may not deploy if the vehicle is involved in a crash, increasing the risk of injury.
Fix. GM will notify owners, and dealers will install two key rings and an insert in the key slot or a cover over the key head on all ignition keys, free of charge. The recall began on September 9, 2014. GM's number for this recall is 14350.
1999 Chevrolet Malibu recalls 3
Fuel System, Other:storage:tank Assembly:pressure Relief Devices
What's wrong. Certain delphi fuel pressure regulators, p/nos. Fp10020-11b1, fp10026-11b1, and fp10027-11b1, sold after january 9, 2007, as aftermarket equipment for various passenger vehicles listed above. The universal pressure regulators (upr) were produced without an o'ring and retainer.
Risk. Fuel may leak, possibly resulting in a fire.
Fix. Delphi will notify owners and replace the upr free of charge. The recall began on april 23, 2007. Owners can contact delphi at 877-411-8770.
Exterior Lighting
What's wrong. Sabersport is recalling 16,270 combination corner and bumper lamp assemblies of various part numbers sold for use as aftermarket equipment for various passenger vehicles. These headlamps fail to conform to the requirements of federal motor vehicle safety standard no. 108, "lamps, reflective devices, and associated equipment." these lamps do not contain the required amber side reflectors.
Risk. Decreased lighting visibility may result in a vehicle crash.
Fix. Sabersport will notify owners and offer a full refund for the noncompliant combination lamps. The safety recall began on may 11, 2009. Owners may contact sabersport at 1-909-598-7589.
Electrical System:ignition
What's wrong. This defect can affect the safe operation of the airbag system. Until this recall is performed, customers should remove all items from their key rings, leaving only the ignition key. The key fob (if applicable), should also be removed from the key ring. General Motors LLC (GM) notified the agency on July 3, 2014, that they are recalling 5,877,718 model year 2000-2005 Chevrolet Impala and Monte Carlo, 1997-2003 Chevrolet Malibu, 2004-2005 Malibu Classic, 1999-2004 Oldsmobile Alero, 1998-2002 Oldsmobile Intrigue, 1999-2005 Pontiac Grand Am and 2004-2008 Pontiac Grand Prix vehicles. In these models, the weight on the key ring and/or road conditions or some other jarring event may cause the ignition switch to move out of the run position, turning off the engine.
Risk. If the key is not in the run position, the air bags may not deploy if the vehicle is involved in a crash, increasing the risk of injury.
Fix. GM will notify owners, and dealers will install two key rings and an insert in the key slot or a cover over the key head on all ignition keys, free of charge. The recall began on September 9, 2014. GM's number for this recall is 14350.
1998 Chevrolet Malibu recalls 5
Visibility:windshield Wiper/washer:linkages
What's wrong. On certain passenger vehicles originally sold in or currently registered in the "salt belt" states: alaska, colorado, connecticut, delaware, idaho, illinois, indiana, iowa, maine, maryland, massachusetts, michigan, minnesota, montana, nebraska, new hampshire, new jersey, new york, north dakota, ohio, pennsylvania, rhode island, south dakota, utah, vermont, west virginia, wisconsin, and wyoming. If a buildup of snow or ice restricts the movement of the passenger side windshield wiper arm, the pivot housing can crack and the wipers will not operate.
Risk. Reduced visibility in inclement weather could lead to a vehicle crash.
Fix. Dealers will replace the passenger side windshield wiper pivot housing. Owner notification began august 14, 2001. Owners who take their vehicles to an authorized dealer on an agreed upon service date and do not receive the free remedy within a reasonable time should contact chevrolet at 1-800-222-1020 or oldsmobile at 1-800-442-6537.
Steering:rack And Pinion
What's wrong. Certain passenger vehicles have lower pinion bearings in the power rack and pinion assembly in which the retainer tabs were not crimped properly. These retainers could fail and permit the ball bearings to escape.
Risk. If this occurs, the pinion shaft can be forced upward during left turns and back down as the steering wheel is moved back and to the right. If the pinion shaft moves further, the driver will need to exert more effort to turn the steering wheel, similar to a vehicle without power assisted steering. If the pinion shaft moves even further, the driver will require much higher effort to turn left and may not be able to turn the wheel as much as intended. With the maximum pinion shaft movement, which requires internal gear component damage, the driver can encounter high resistance to turning left, followed by unintended power assist to the right. In any of these conditions, a crash could occur.
Fix. Dealers will install a new lower pinion bearing unless inspect of the existing bearing indicates that replacement of the gear assembly is necessary. Owner notification began on february 5, 2004. Owners should contact buick at 1-866-608-8080; chevrolet at 1-800-630-2438; oldsmobile at 1-800-630-6537; or pontiac at 1-800-620-7668.
Fuel System, Other:storage:tank Assembly:pressure Relief Devices
What's wrong. Certain delphi fuel pressure regulators, p/nos. Fp10020-11b1, fp10026-11b1, and fp10027-11b1, sold after january 9, 2007, as aftermarket equipment for various passenger vehicles listed above. The universal pressure regulators (upr) were produced without an o'ring and retainer.
Risk. Fuel may leak, possibly resulting in a fire.
Fix. Delphi will notify owners and replace the upr free of charge. The recall began on april 23, 2007. Owners can contact delphi at 877-411-8770.
Exterior Lighting
What's wrong. Sabersport is recalling 16,270 combination corner and bumper lamp assemblies of various part numbers sold for use as aftermarket equipment for various passenger vehicles. These headlamps fail to conform to the requirements of federal motor vehicle safety standard no. 108, "lamps, reflective devices, and associated equipment." these lamps do not contain the required amber side reflectors.
Risk. Decreased lighting visibility may result in a vehicle crash.
Fix. Sabersport will notify owners and offer a full refund for the noncompliant combination lamps. The safety recall began on may 11, 2009. Owners may contact sabersport at 1-909-598-7589.
Electrical System:ignition
What's wrong. This defect can affect the safe operation of the airbag system. Until this recall is performed, customers should remove all items from their key rings, leaving only the ignition key. The key fob (if applicable), should also be removed from the key ring. General Motors LLC (GM) notified the agency on July 3, 2014, that they are recalling 5,877,718 model year 2000-2005 Chevrolet Impala and Monte Carlo, 1997-2003 Chevrolet Malibu, 2004-2005 Malibu Classic, 1999-2004 Oldsmobile Alero, 1998-2002 Oldsmobile Intrigue, 1999-2005 Pontiac Grand Am and 2004-2008 Pontiac Grand Prix vehicles. In these models, the weight on the key ring and/or road conditions or some other jarring event may cause the ignition switch to move out of the run position, turning off the engine.
Risk. If the key is not in the run position, the air bags may not deploy if the vehicle is involved in a crash, increasing the risk of injury.
Fix. GM will notify owners, and dealers will install two key rings and an insert in the key slot or a cover over the key head on all ignition keys, free of charge. The recall began on September 9, 2014. GM's number for this recall is 14350.
1997 Chevrolet Malibu recalls 6
Air Bags:frontal
What's wrong. Vehicle description: passenger vehicles. The fasteners that secure the passenger air bag module to the instrument panel tie bar were omitted.
Risk. If the air bag deploys, the module could separate from the instrument panel striking and injuring an occupant.
Fix. Dealers will inspect the air bag module for the presence of the fasteners and, if necessary, install any fasteners that may have been omitted.
Visibility:windshield Wiper/washer:linkages
What's wrong. On certain passenger vehicles originally sold in or currently registered in the "salt belt" states: alaska, colorado, connecticut, delaware, idaho, illinois, indiana, iowa, maine, maryland, massachusetts, michigan, minnesota, montana, nebraska, new hampshire, new jersey, new york, north dakota, ohio, pennsylvania, rhode island, south dakota, utah, vermont, west virginia, wisconsin, and wyoming. If a buildup of snow or ice restricts the movement of the passenger side windshield wiper arm, the pivot housing can crack and the wipers will not operate.
Risk. Reduced visibility in inclement weather could lead to a vehicle crash.
Fix. Dealers will replace the passenger side windshield wiper pivot housing. Owner notification began august 14, 2001. Owners who take their vehicles to an authorized dealer on an agreed upon service date and do not receive the free remedy within a reasonable time should contact chevrolet at 1-800-222-1020 or oldsmobile at 1-800-442-6537.
Steering:rack And Pinion
What's wrong. Certain passenger vehicles have lower pinion bearings in the power rack and pinion assembly in which the retainer tabs were not crimped properly. These retainers could fail and permit the ball bearings to escape.
Risk. If this occurs, the pinion shaft can be forced upward during left turns and back down as the steering wheel is moved back and to the right. If the pinion shaft moves further, the driver will need to exert more effort to turn the steering wheel, similar to a vehicle without power assisted steering. If the pinion shaft moves even further, the driver will require much higher effort to turn left and may not be able to turn the wheel as much as intended. With the maximum pinion shaft movement, which requires internal gear component damage, the driver can encounter high resistance to turning left, followed by unintended power assist to the right. In any of these conditions, a crash could occur.
Fix. Dealers will install a new lower pinion bearing unless inspect of the existing bearing indicates that replacement of the gear assembly is necessary. Owner notification began on february 5, 2004. Owners should contact buick at 1-866-608-8080; chevrolet at 1-800-630-2438; oldsmobile at 1-800-630-6537; or pontiac at 1-800-620-7668.
Fuel System, Other:storage:tank Assembly:pressure Relief Devices
What's wrong. Certain delphi fuel pressure regulators, p/nos. Fp10020-11b1, fp10026-11b1, and fp10027-11b1, sold after january 9, 2007, as aftermarket equipment for various passenger vehicles listed above. The universal pressure regulators (upr) were produced without an o'ring and retainer.
Risk. Fuel may leak, possibly resulting in a fire.
Fix. Delphi will notify owners and replace the upr free of charge. The recall began on april 23, 2007. Owners can contact delphi at 877-411-8770.
Exterior Lighting
What's wrong. Sabersport is recalling 16,270 combination corner and bumper lamp assemblies of various part numbers sold for use as aftermarket equipment for various passenger vehicles. These headlamps fail to conform to the requirements of federal motor vehicle safety standard no. 108, "lamps, reflective devices, and associated equipment." these lamps do not contain the required amber side reflectors.
Risk. Decreased lighting visibility may result in a vehicle crash.
Fix. Sabersport will notify owners and offer a full refund for the noncompliant combination lamps. The safety recall began on may 11, 2009. Owners may contact sabersport at 1-909-598-7589.
Electrical System:ignition
What's wrong. This defect can affect the safe operation of the airbag system. Until this recall is performed, customers should remove all items from their key rings, leaving only the ignition key. The key fob (if applicable), should also be removed from the key ring. General Motors LLC (GM) notified the agency on July 3, 2014, that they are recalling 5,877,718 model year 2000-2005 Chevrolet Impala and Monte Carlo, 1997-2003 Chevrolet Malibu, 2004-2005 Malibu Classic, 1999-2004 Oldsmobile Alero, 1998-2002 Oldsmobile Intrigue, 1999-2005 Pontiac Grand Am and 2004-2008 Pontiac Grand Prix vehicles. In these models, the weight on the key ring and/or road conditions or some other jarring event may cause the ignition switch to move out of the run position, turning off the engine.
Risk. If the key is not in the run position, the air bags may not deploy if the vehicle is involved in a crash, increasing the risk of injury.
Fix. GM will notify owners, and dealers will install two key rings and an insert in the key slot or a cover over the key head on all ignition keys, free of charge. The recall began on September 9, 2014. GM's number for this recall is 14350.
1983 Chevrolet Malibu recalls 3
Vehicle Speed Control:cables
What's wrong. Accelerator pump lever retaining pin may loosen after repeated heavy accelerator pedal applications. This could cause the throttle to become stuck in the open position.
Fix. Dealer will install a special cotter pin, to retain the accelerator pump pin, and a spring clip thrust washer on the accelerator pump link.
Service Brakes, Hydraulic:foundation Components:hoses, Lines/piping, And Fittings
What's wrong. The master cylinder rear brake pipe, which carries brake fluid to the rear brakes, may develop a leak due to extended chafing on the air cleaner resonator bracket.
Fix. If upon inspection the dealer finds that there is inadequate clearance, the pipe will be reformed to obtain the necessary three quarter inch space. Only those pipes showing signs of wear will be replaced.
Equipment
What's wrong. Certain honeywell fram racing brand hp4 and hp8 oil filters that were manufactured from may 25, 2006, through september 14, 2007, and sold for use as replacement equipment for vehicles list above. The affected filters are marked with a date code a61451 through a72571 sequentially. The date code and part number appear on the filter housing. Fram racing hp4 and hp8 oil filters not bearing a date code in this range are not affected by this recall. The gasket of the oil filter becomes more pliable under high temperatures and pressures.
Risk. This condition may cause inadequate sealing and loss of engine oil, possibly resulting in a fire.
Fix. Honeywell will replace the affected oil filters free of charge. The recall began during november 2007. Owners can contact fram customer service toll-free at 1-800-890-2075.
1982 Chevrolet Malibu recalls 3
Vehicle Speed Control:cables
What's wrong. Accelerator pump lever retaining pin may loosen after repeated heavy accelerator pedal applications. This could cause the throttle to become stuck in the open position.
Fix. Dealer will install a special cotter pin, to retain the accelerator pump pin, and a spring clip thrust washer on the accelerator pump link.
Fuel System, Gasoline:fuel Injection System
What's wrong. Under certain vehicle operating conditions, the governor weight retainer in the injection pump may fail. The throttle valve could stick, preventing return to idle and shut down of the engine by the driver.
Fix. Dealer will replace the governor weight assembly in the injection pump at no cost to owner.
Equipment
What's wrong. Certain honeywell fram racing brand hp4 and hp8 oil filters that were manufactured from may 25, 2006, through september 14, 2007, and sold for use as replacement equipment for vehicles list above. The affected filters are marked with a date code a61451 through a72571 sequentially. The date code and part number appear on the filter housing. Fram racing hp4 and hp8 oil filters not bearing a date code in this range are not affected by this recall. The gasket of the oil filter becomes more pliable under high temperatures and pressures.
Risk. This condition may cause inadequate sealing and loss of engine oil, possibly resulting in a fire.
Fix. Honeywell will replace the affected oil filters free of charge. The recall began during november 2007. Owners can contact fram customer service toll-free at 1-800-890-2075.
1981 Chevrolet Malibu recalls 3
Suspension:rear
What's wrong. The bolts that attach the lower rear control arm to the frame may fracture. The rear control arm supports and positions the rear axle. Fracture of the bolts would allow the control arm to drop free.
Fix. Both rear control arm attachment bolts will be replaced without charge.
Vehicle Speed Control:cables
What's wrong. Accelerator pump lever retaining pin may loosen after repeated heavy accelerator pedal applications. This could cause the throttle to become stuck in the open position.
Fix. Dealer will install a special cotter pin, to retain the accelerator pump pin, and a spring clip thrust washer on the accelerator pump link.
Equipment
What's wrong. Certain honeywell fram racing brand hp4 and hp8 oil filters that were manufactured from may 25, 2006, through september 14, 2007, and sold for use as replacement equipment for vehicles list above. The affected filters are marked with a date code a61451 through a72571 sequentially. The date code and part number appear on the filter housing. Fram racing hp4 and hp8 oil filters not bearing a date code in this range are not affected by this recall. The gasket of the oil filter becomes more pliable under high temperatures and pressures.
Risk. This condition may cause inadequate sealing and loss of engine oil, possibly resulting in a fire.
Fix. Honeywell will replace the affected oil filters free of charge. The recall began during november 2007. Owners can contact fram customer service toll-free at 1-800-890-2075.
Best and worst years for the Chevrolet Malibu
Based on NHTSA owner-complaint volume across 33 tracked years, the worst years are 2004, 2009, 2005 and the best (fewest complaints) are 2026, 1983, 1981.
ForCar aggregate — our own analysis of complaint volume, not published by NHTSA.
| Year | Owner complaints | Top issue | Verdict |
|---|---|---|---|
| 1981 Malibu | 3 | Service Brakes | Best |
| 1982 Malibu | 3 | Fuel System | Average |
| 1983 Malibu | 1 | Visibility | Best |
| 1997 Malibu | 514 | Service Brakes | Average |
| 1998 Malibu | 1084 | Service Brakes | Average |
| 1999 Malibu | 848 | Service Brakes | Average |
| 2000 Malibu | 979 | Service Brakes | Average |
| 2001 Malibu | 749 | Electrical System | Average |
| 2002 Malibu | 596 | Electrical System | Average |
| 2003 Malibu | 610 | Electrical System | Average |
| 2004 Malibu | 1697 | Steering | Avoid |
| 2005 Malibu | 1393 | Steering | Avoid |
| 2006 Malibu | 1385 | Steering | Average |
| 2007 Malibu | 991 | Steering | Average |
| 2008 Malibu | 1014 | Steering | Average |
| 2009 Malibu | 1507 | Steering | Avoid |
| 2010 Malibu | 1359 | Steering | Average |
| 2011 Malibu | 973 | Electrical System | Average |
| 2012 Malibu | 904 | Electrical System | Average |
| 2013 Malibu | 921 | Electrical System | Average |
| 2014 Malibu | 361 | Engine | Average |
| 2015 Malibu | 266 | Engine | Average |
| 2016 Malibu | 856 | Engine | Average |
| 2017 Malibu | 715 | Engine | Average |
| 2018 Malibu | 684 | Engine | Average |
| 2019 Malibu | 187 | Power Train | Average |
| 2020 Malibu | 188 | Engine | Average |
| 2021 Malibu | 74 | Electrical System | Average |
| 2022 Malibu | 81 | Electrical System | Average |
| 2023 Malibu | 39 | Electrical System | Average |
| 2024 Malibu | 20 | Electrical System | Average |
| 2025 Malibu | 5 | Back Over Prevention | Average |
| 2026 Malibu | 0 | — | Best |
What are the most common Chevrolet Malibu problems?
The most-reported Chevrolet Malibu problems are Air (88 reports), Other (52 reports) and Seats (505 reports) — out of 21,007 owner complaints NHTSA holds for the model. Here's how they break down:
Most-reported components — tap a category to read what owners actually experienced:
Steering 6,269 Read
Airbags and side airbags didn't deploy, steering locked up and wheel separated form axel
On 28 feb 2016 around 11:50 am, me, my two daughters and my mom was headed north on i-185. While riding we were talking about what we was going to put in the house we had just gotten approved for that friday and in mid conversation as i'm going around the curve my car goes over the fog line and i couldn't get the car back into my lane and before i knew it i hit the median (wall) on the left side, my hood flew up and the car bounced off the wall and all i really remember from that point is smashing on break but apparently the car kept going, hit the right side of the wall and came to a stop there. Next thing i know a man was waking me up asking am i okay and said help was on the way. I heard my daughter crying for her sister because she wouldn't move so i get out the car and began to get them out to assure they're okay and everything else is really a blur. I remember a man helping my mom out the car as me and my kids sat on the ground waiting for help and i remember going to the hospital with my kids.
2005 chevrolet malibu car veered to left and crossed median. Driver of malibu killed and also struck another car where passengers were injured. Witness stated malibu braked and there were tire marks, no vehicle in front of malibu at time of braking. Witness stated car veered to left and driver appeared to lose control crossing median and struck another automobile. Witness states driver was not on a cell phone. This information is in the police report. The chevrolet malibu had steering shaft replaced prior to accident. This was performed at gm dealer due to popping noise while steering, diagnosed at dealer. Repair paid for by owner. Chevy malibu had 65,000 miles at time of accident. *tr
Issue 1 Changing lanes at a red light and car steering wheel locked up causing the car to go one lane too many to the right and get struck by another vehicle Issue 2 car shuts off at every stop and hesitates to take off causing unsafe conditions
I was on 44 just turned on 41 no cars on left or right none behind proceeding across traffic light other party was making a right turn i was stopping brakes ankle was fractured and we had a head on colision. *tr
Tl* the contact owned a 2006 chevrolet malibu. While driving approximately 65 mph, the steering wheel seized without warning. The driver crashed into a ditch and the vehicle rolled over approximately four times. The driver and two passengers were injured and required medical attention. A police report was filed. The vehicle was destroyed and towed to a tow lot. The manufacturer was not made aware of the failure. The failure mileage was 130,000.
Tl* the contact owns a 2005 chevrolet malibu. While driving 55 mph on an incline in inclement weather, the vehicle began to spin and the contact crashed into a guardrail multiple times. The steering wheel completely fractured from the vehicle and the air bags failed to deploy. The contact sustained minor neck and left arm injuries that required medical attention. The front passenger sustained thigh injuries and the rear passenger side passenger did not sustain any injuries. Both passengers did not require medical attention. A police report was filed. The vehicle was towed from the crash scene to the contact's residence. The vehicle was not diagnosed or repaired. The manufacturer was not notified of the failure. The vin was included in nhtsa campaign number: 14v153000 (steering). The failure mileage was 223,000.
I wanted to submit my complaint after receiving a recall letter about my former car. In december of 2013 i was driving on the road after it had rained. I lost control of the vehicle. Car went off the edge of the road. Was unable to control car through steering or braking. We slid down the hill fishtailing. Rear end hit signs which sent me into a spin and shattered the rear window. Front of car was stopped by several trees- cracking windshield/crushing front end. Deploying air bags. Car was totaled. My two children in the back seat had seat belt burn and cuts from glass. I had multiple bruises, cuts, burn from seat belt. Hit head and briefly lost consciousness. As a result it aggravated my chronic pain condition. *tr
This vehicle had a crash with fatalities in 2006. General motors never issued a unintended ignition turnoff on this vehicle until aug2014. The crash began with an uncontrollable and unexpected spinout, there was no ability to steer, brake and air bags did not deploy. These are the exact conditions listed in the gm recall. Gm will not accept a filing for this make and model vehicle and should be added to the gm ignition failure claim program. Nhtsa didn't all the gm recall to malibu's but i have notified them of the oversight. This should be corrected and compensation provided by gm. This is the exact wording on the gm recall website: the following recalls have been found for your 1998 chevrolet malibu results last updated: sep 16, 2014 gm recall #: n140350 nhtsa recall #: 14v400 date issued: aug 12, 2014 unintended ignition key rotation recall description: general motors has decided that a defect which relates to motor vehicle safety exists in 2000-2005 my chevrolet impala and monte carlo, 1997-2005 my chevrolet malibu, 1999-2004 my oldsmobile alero, 1998-2002 my oldsmobile intrigue, 1999-2005 my pontiac grand am, and 2004-2008 my pontiac grand prix vehicles. If the key ring is carrying added weight and the vehicle goes off road or experiences some other jarring event, it may unintentionally move the key away from the run position. If this occurs, engine power, power steering and power braking may be affected, increasing the risk of a crash. Safety risk description: the timing of the key movement out of the run position, relative to the activation of the sensing algorithm of the crash event, may result in the airbags not deploying, increasing the potential for occupant injury in certain kinds of crashes. *tr
This vehicle had a crash with fatalities in 2006. General motors never issued a unintended ignition turnoff on this vehicle until aug2014. The crash began with an uncontrollable and unexpected spinout, there was no ability to steer, brake and air bags did not deploy. These are the exact conditions listed in the gm recall. Gm will not accept a filing for this make and model vehicle and should be added to the gm ignition claim program. An innocent person has a been convicted of manslaughter and this should be corrected immediately and compensation provided by gm. This is the exact wording on the gm recall website: the following recalls have been found for your 1998 chevrolet malibu results last updated: sep 16, 2014 gm recall #: n140350 nhtsa recall #: 14v400 date issued: aug 12, 2014 unintended ignition key rotation recall description: general motors has decided that a defect which relates to motor vehicle safety exists in 2000-2005 my chevrolet impala and monte carlo, 1997-2005 my chevrolet malibu, 1999-2004 my oldsmobile alero, 1998-2002 my oldsmobile intrigue, 1999-2005 my pontiac grand am, and 2004-2008 my pontiac grand prix vehicles. If the key ring is carrying added weight and the vehicle goes off road or experiences some other jarring event, it may unintentionally move the key away from the run position. If this occurs, engine power, power steering and power braking may be affected, increasing the risk of a crash. Safety risk description: the timing of the key movement out of the run position, relative to the activation of the sensing algorithm of the crash event, may result in the airbags not deploying, increasing the potential for occupant injury in certain kinds of crashes. *tr
Electrical System 5,039 Read
Engine power reduced defect, causing affected models to lose power while driving at highway speeds. My son’s was driving 55 mph and then all of sudden the car decelerated to 20 mph in minutes before his 2016 Malibu stalled on [XXX]. Unfortunately the car did not make it to the emergency lane and as a result a SUV hit his car killing my daughter who was 33 weeks pregnant. The baby survived with lifelong injuries. Despite this recall, GM failed to notify vehicle owners, including the owner of the vehicle involved in the fatal accident on [XXX], in Dallas, Texas, resulting in my daughter’s death. This defect has been found in several 2016 Malibus, prompting a class action lawsuit against GM. Plaintiffs in the class action lawsuit reported having to restart their vehicles or replace faulty accelerator pedal position sensors to address the issue. GM's failure to notify vehicle owners of the safety recall constitutes negligence and gross negligence. INFORMATION REDACTED PURSUANT TO THE FREEDOM OF INFORMATION ACT (FOIA), 5 U.S.C. 552(B)(6)
On 28 feb 2016 around 11:50 am, me, my two daughters and my mom was headed north on i-185. While riding we were talking about what we was going to put in the house we had just gotten approved for that friday and in mid conversation as i'm going around the curve my car goes over the fog line and i couldn't get the car back into my lane and before i knew it i hit the median (wall) on the left side, my hood flew up and the car bounced off the wall and all i really remember from that point is smashing on break but apparently the car kept going, hit the right side of the wall and came to a stop there. Next thing i know a man was waking me up asking am i okay and said help was on the way. I heard my daughter crying for her sister because she wouldn't move so i get out the car and began to get them out to assure they're okay and everything else is really a blur. I remember a man helping my mom out the car as me and my kids sat on the ground waiting for help and i remember going to the hospital with my kids.
The Apple CarPlay system, specifically the GPS/navigation function, froze and malfunctioned. This occurred in two separate vehicles I’ve owned: a 2019 Chevy Malibu and now a 2019 Chevy Equinox (the vehicle involved in the accident). Both cars frequently experienced lagging and freezing while using Apple CarPlay. The infotainment system and vehicle are available for inspection. On June 28, 2025, while driving at night with GPS active via CarPlay, the system froze and gave me an incorrect instruction — telling me to turn left onto a one-way street in the wrong direction. I did not realize I was going the wrong way until reaching the intersection, and by that point, I was involved in a head-on car accident. This presented a significant danger to me and others on the road. The issue has not been officially reproduced or confirmed by a service center, but it occurred consistently in two different GM vehicles. I have text message documentation sent to my family over the months before the accident describing the freezing and lagging of CarPlay. The accident and vehicle were reviewed by insurance representatives, but no inspection was done specifically on the infotainment/GPS system by the manufacturer. There were no warning lamps or dashboard messages. However, the symptom was consistent lagging and freezing of the CarPlay interface, which had been happening for months prior. There were no official error codes displayed before the crash.
I was riding in the car with my wife and cousin heading to her brothers house. We had just drove from out of town after visiting some family members and was taking my cousin back home. While driving i notice the car electrical system acting up it would say i needed to put air in the tire or the back tire was not functioning correctly. It also would say i needed to put my seat belt on when it was on. But this was not my biggest concern my wife while driving ran off the road a struck a tree head on. Had she had been driving faster then what she was going i fell as if she would have been severely injured. The airbags never came out and this was a concern because who knows how many vehicles are affected by this. I thank god that her injuries were not that serve as well as my cousin and i, although pain will heal the pain of losing a love one will never heal. So i ask that you look into because this is a safety concern, i know if had my wife been told that her airbags may or may not deploy she would have never brought the car....... *tr
My husband was killed in an accident involving this vehicle. It says in the accident report that the bcm was unresponsive as well as another computer system and the wipers were on in dry weather. I believe a defect contributed to the accident. My husband was traveling with the right of way on a motorcycle when the sedan left turned in front of him. I will give you more information when i receive some documents from other family members. Thank you *tr
The passlock system and fuel rail combined created a injury to pedestrians that is unbelievable the car took off after left turn into a parking lot
This vehicle had a crash with fatalities in 2006. General motors never issued a unintended ignition turnoff on this vehicle until aug2014. The crash began with an uncontrollable and unexpected spinout, there was no ability to steer, brake and air bags did not deploy. These are the exact conditions listed in the gm recall. Gm will not accept a filing for this make and model vehicle and should be added to the gm ignition claim program. An innocent person has a been convicted of manslaughter and this should be corrected immediately and compensation provided by gm. This is the exact wording on the gm recall website: the following recalls have been found for your 1998 chevrolet malibu results last updated: sep 16, 2014 gm recall #: n140350 nhtsa recall #: 14v400 date issued: aug 12, 2014 unintended ignition key rotation recall description: general motors has decided that a defect which relates to motor vehicle safety exists in 2000-2005 my chevrolet impala and monte carlo, 1997-2005 my chevrolet malibu, 1999-2004 my oldsmobile alero, 1998-2002 my oldsmobile intrigue, 1999-2005 my pontiac grand am, and 2004-2008 my pontiac grand prix vehicles. If the key ring is carrying added weight and the vehicle goes off road or experiences some other jarring event, it may unintentionally move the key away from the run position. If this occurs, engine power, power steering and power braking may be affected, increasing the risk of a crash. Safety risk description: the timing of the key movement out of the run position, relative to the activation of the sensing algorithm of the crash event, may result in the airbags not deploying, increasing the potential for occupant injury in certain kinds of crashes. *tr
Tl* the contact owns a 2015 chevrolet malibu. The contact stated that while driving approximately 45 mph the vehicle started to drive to the right and the wheels began to lose traction before the steering wheel became difficult to turn causing the driver to lose control of the steering. The vehicle then spun out and crashed into a ditch. The contact stated that all air bags deployed except for the driver's frontal air bag. The driver sustained lower back and left shoulder injuries however had not sought medical attention due to covid-19. The contact stated that a police officer was driving behind her and stopped to assist. Police report was filed. The vehicle was not towed. The cause of the failure was not determined. The local dealer and manufacturer were not notified of the failure. Also, the vehicle had previously experienced electrical problems which caused the doors, locking the driver inside the vehicle. The contact stated at the time of the electrical failure there was a burning odor coming from the vents. The vehicle was taken to lynch chevrolet of mukwonago (280 east wolf run mukwonago, wi 53149) who replaced an electrical harness and module. No further info was available. The vehicle had experienced a shift to park failure and the vehicle would not immediately shut off. The vehicle was taken to the local dealer and the transmission shift control assembly was replaced but the failure would still occur. The manufacturer was not notified of the failures. The failure mileage was 65,000. *dt*jb
My service traction control light was coming on ever since i bought my car and i took it to koons for service and i was told one wheel was moving faster then another not to worry about it then on 06/18/2014 iwas hit by a chevy silverado that ran a light and i was doing 45 miles an hour i had my granddaughter in her safety seat in the back none of my air bags worked nor did my seat belts my grand daughter hit the back of the seats.now my car is flashing the codes again now that its fixed and shuts down while driving .its part of the gm recall for the upper wire harness but they are saying it isn't and they are not standing buy the warranty this defect almost killed us and still is almost killing us by shutting down while driving service traction control lights coming on plus air bag lights saying air bags are shutting down .so that means the air bags if we needed them would not help us again if needed.we were very badly hurt the last time and i need gm to step up and reimburse us for our injuries and for making us still ride in an unsafe car that they now is on the recall list but they keep saying its not.my car is still in service and service is saying it is part of the recall bit gm will not take responsibility. .. *tr
Right now i have the service esc and service traction light on again for the 3rd time. I took each time to chevy classic in grapevine tx and they told me no codes the 1st time, took it to clay cooley in irving--light came on then no codes they showed. Today 4-15=16 light came on again and i took it to classic chevy and they found 3 codes this time. They say i will have to pay for this! I should not since there was an open recall on 5/14/2014 for 2010 malibu's. My car is doing this now !@!!@ it needs to be fixed at no charge to me!! I feel like this is the most dangerous car on the road for me and my daughter. I don't want to be a statistic if we have a car crash and it was all because chevy kept making excuses to not fix my crap car for me. The other recall was the brake system not illuminating i got that letter a little too late . Someone rear ended me in oct 2012 while i was stopped at a red light. Maybe those stupid back brake lights were not working then!!!!!! Someone at classic or clay cooolye chevy needs to fix this esc light on my car and fix all the recalls for free. I also have an eps recall letter that was sent to me but someone at chevy told me the light has to come on for them to fix it. This is ridiculous. My car needs to be fixed for all these problems it has no matter if the light is on or not. But the light is on for service esc and traction right now!@ gm or chevy needs to pay for it and fix this car. The consumer stated the dealer did not completely fix the problem. They only lubricated and she continued to experience problems with the brakes, service light and esc light. Also, the front axle was leaking.
Service Brakes 2,626 Read
Driving 2007 chevrolet malibu when another vehicle pulled out of side street proceeded to engage brakes and vehicle skidded out of control causing accident. A b s failure and traction control failure causing vehicle to be total loss. *tr
Airbags deployed when i hit the brakes in 2008.
Anti-lock brakes possibly failed. *tt
The contact owns a 2020 Chevrolet Malibu. The contact stated that while driving approximately 45 MPH and approaching a stop light the braking system malfunctioned when pressing the brake pedal causing the vehicle to crash into the rear of a second vehicle. The contact indicated that the vehicle did not reduce speed when pressing the brake pedal and the collision avoidance feature did not activate. A police report was taken at the scene. The police officer also confirmed no skid marks at the crash site. During the crash, the contact sustained injuries to the left arm and right shoulder that did not require medical attention. Both the driver and front seat passenger of the second vehicle sustained undisclosed injuries and were transported to the hospital. The vehicle was towed away and later deemed destroyed by the insurance company. The cause of the failure has not yet been determined. The manufacturer was notified of the incident. The local dealer was not contacted. The failure mileage was 57,000.
I was involved in a collison with another vehicle. Immediatly after the collision the brakes on my vehicle failed. I had to use the curb and bushes to stop my vehicle after traveling approximately 300 yards from the collision site.
I was on 44 just turned on 41 no cars on left or right none behind proceeding across traffic light other party was making a right turn i was stopping brakes ankle was fractured and we had a head on colision. *tr
In july of 2005 i was involved in a accident due to the fact i was unable to stop this vehicle. I did not realize at the time that i had the ability to file a complaint to a federal safety organization. This vehicle has now had 5 brake jobs, the last being today. The front rotors had to be repaired because the vehicle was difficult to stop and had severe vibration during braking. The mileage on this vehicle is 101000 miles. At the last brake overhaul it was noted that the rear brakes were not working, ( the vehicle was delivered to me this way new) this problem was reported as repaired. I purchased this vehicle new from gamblin motors in apr 1999 and as i have stated 5 brake repairs in 101000 miles. In july 2005 the reason i rear ended a vehicle was i was unable to stop due to poor braking action. This vehicle has had 3 sets of front rotors and brake pads and the rotors have been turned (trued on 2 separate occasions). I have filed complaints with gm about this problem and it has been disregarded. This may be because the original complaint was because of coolant system leaks that caused damage to the engine. *nm
When appyling brakes in an emergency abs system failed to activate, and pedal went to the floor, causing extended stopping distance, cause unknown. *ak after three visits to the dealer for brake problem, the abs system failed again resulting in accident. *yh
This vehicle had a crash with fatalities in 2006. General motors never issued a unintended ignition turnoff on this vehicle until aug2014. The crash began with an uncontrollable and unexpected spinout, there was no ability to steer, brake and air bags did not deploy. These are the exact conditions listed in the gm recall. Gm will not accept a filing for this make and model vehicle and should be added to the gm ignition failure claim program. Nhtsa didn't all the gm recall to malibu's but i have notified them of the oversight. This should be corrected and compensation provided by gm. This is the exact wording on the gm recall website: the following recalls have been found for your 1998 chevrolet malibu results last updated: sep 16, 2014 gm recall #: n140350 nhtsa recall #: 14v400 date issued: aug 12, 2014 unintended ignition key rotation recall description: general motors has decided that a defect which relates to motor vehicle safety exists in 2000-2005 my chevrolet impala and monte carlo, 1997-2005 my chevrolet malibu, 1999-2004 my oldsmobile alero, 1998-2002 my oldsmobile intrigue, 1999-2005 my pontiac grand am, and 2004-2008 my pontiac grand prix vehicles. If the key ring is carrying added weight and the vehicle goes off road or experiences some other jarring event, it may unintentionally move the key away from the run position. If this occurs, engine power, power steering and power braking may be affected, increasing the risk of a crash. Safety risk description: the timing of the key movement out of the run position, relative to the activation of the sensing algorithm of the crash event, may result in the airbags not deploying, increasing the potential for occupant injury in certain kinds of crashes. *tr
This vehicle had a crash with fatalities in 2006. General motors never issued a unintended ignition turnoff on this vehicle until aug2014. The crash began with an uncontrollable and unexpected spinout, there was no ability to steer, brake and air bags did not deploy. These are the exact conditions listed in the gm recall. Gm will not accept a filing for this make and model vehicle and should be added to the gm ignition claim program. An innocent person has a been convicted of manslaughter and this should be corrected immediately and compensation provided by gm. This is the exact wording on the gm recall website: the following recalls have been found for your 1998 chevrolet malibu results last updated: sep 16, 2014 gm recall #: n140350 nhtsa recall #: 14v400 date issued: aug 12, 2014 unintended ignition key rotation recall description: general motors has decided that a defect which relates to motor vehicle safety exists in 2000-2005 my chevrolet impala and monte carlo, 1997-2005 my chevrolet malibu, 1999-2004 my oldsmobile alero, 1998-2002 my oldsmobile intrigue, 1999-2005 my pontiac grand am, and 2004-2008 my pontiac grand prix vehicles. If the key ring is carrying added weight and the vehicle goes off road or experiences some other jarring event, it may unintentionally move the key away from the run position. If this occurs, engine power, power steering and power braking may be affected, increasing the risk of a crash. Safety risk description: the timing of the key movement out of the run position, relative to the activation of the sensing algorithm of the crash event, may result in the airbags not deploying, increasing the potential for occupant injury in certain kinds of crashes. *tr
Engine 2,206 Read
Engine power reduced defect, causing affected models to lose power while driving at highway speeds. My son’s was driving 55 mph and then all of sudden the car decelerated to 20 mph in minutes before his 2016 Malibu stalled on [XXX]. Unfortunately the car did not make it to the emergency lane and as a result a SUV hit his car killing my daughter who was 33 weeks pregnant. The baby survived with lifelong injuries. Despite this recall, GM failed to notify vehicle owners, including the owner of the vehicle involved in the fatal accident on [XXX], in Dallas, Texas, resulting in my daughter’s death. This defect has been found in several 2016 Malibus, prompting a class action lawsuit against GM. Plaintiffs in the class action lawsuit reported having to restart their vehicles or replace faulty accelerator pedal position sensors to address the issue. GM's failure to notify vehicle owners of the safety recall constitutes negligence and gross negligence. INFORMATION REDACTED PURSUANT TO THE FREEDOM OF INFORMATION ACT (FOIA), 5 U.S.C. 552(B)(6)
Tl* the contact owns a 2005 chevrolet malibu classic. Contact stated that while driving approximately 60 mph, the vehicle stalled without warning. As a result, the contact lost control of the vehicle which rolled over three times. The air bags failed to deploy. The contact stated that the driver and two passengers sustained unknown injuries. A police report was filed of the incident. The vehicle was destroyed. The manufacturer was not notified of the failure. The vin was unavailable. The approximate failure mileage was 100,000. Updated 12/9/14*cn the consumer did not receive a recall notification. Updated 06/1/2015 *js
The contact owns a 2019 Chevrolet Malibu. The contact stated that while at a light, the engine lost motive power and shut off. The vehicle began to roll backward. The emergency brake was inoperable. The vehicle shifted from park. The contact continued to pull the emergency brake, but it failed to respond. The contact attempted to turn the vehicle off, but it failed to turn off. The vehicle crashed into a ditch. The passenger sustained injuries to her head. The driver sustained injuries to his shoulder. The occupants did not receive any medical attention. There was no fire or air bag deployment. A police report was filed. The vehicle was towed to a tow lot. The local dealer was not contacted. The vehicle was not diagnosed or repaired. The manufacturer was not notified of the failure. The failure mileage was approximately 105,800.
Engine light has been on and off for the pass year.this is a 2017 and this should not be happening this soon. I took the vehicle to the dealer and they changed the battery. About 2 months later the light came back on. I took it back to the dealer and the person let me know the battery is fine. The code that came up on the computer i believe is p011, something with the air filter. I was told i have to pay this time because my warranty was no longer valid. This car is only 3 years old my engine light should not be on this soon. My car is in motion when the light comes on and off. *tr
On jan 6 2020. I was driving a 2016 chevy malibu, when the check engine light and engine reduce power light came on. I pulled over and let the car seat for maybe 10 mins. I restarted the vehicle and begin driving again (it was pulling normal). About 3 miles down the road i was making a left turn and the car stop pulling and the reduce engine power light comes on which leaves me in the middle of a intersection section causing a vehicle coming from my right side to slam into the side of vehicle deploying all of my airbags and making on-star assistance come on. In the result i have neck, back and side injury from the impact. Which in the result i'm getting sued because my car stalled in the middle of the turn going left. My car was totaled out and my insurance don't want to pay the full value of what i was leasing it for. Which i have to come out the pocket with expenses. After reviewing the "engine reduce power" and doing my research i come to find out it has been numerous complaints. I could have lost my life!
Car was forced off road then rolled over into on coming traffic. *tr
Start/stop on powertrain / motor control. Motor stops on brake pedal pressure and starts upon ? ? Decrease in pedal prssure ? Motor started and rpm accelerated bu itself while brake pedal applied, vehicle "surged" and hit post. Motor accelerates rpm / works by itself. Problem is intermittent. Delay in "start / stop" causing surge. Software programming problem ?
Tl* the contact's daughter was driving a 2018 chevrolet malibu. While driving 35 mph, the vehicle stalled. When the brake pedal was depressed, the vehicle failed to come to a complete stop. As a result, the driver crashed into a parked vehicle. The air bags deployed. The police were notified, but the contact was not sure if a report was generated. The driver sustained injuries to the pelvic area and around her waist from the seat belt that required medical attention. The vehicle was towed to a local repair shop awaiting diagnostic testing from the insurance company. The manufacturer was called, but the contact was unable to speak with a representative. The dealer was not contacted. The failure mileage was approximately 17,500.
The contact owned a 2017 Chevrolet Malibu. The contact stated that while backing out of the driveway, the engine revved up and accelerated independently. The contact's vehicle accelerated independently in reverse(R) and clipped the tow hitch of a vehicle parked on the street, and that was where the vehicle came to a stop. No air bags deployed. There were no injuries sustained. The vehicle was towed to the dealer. The vehicle was inspected. However, no cause for the failure was found. The contact stated that on a separate occasion, while parking in reverse into the contact's assigned parking space, the engine revved up and accelerated independently. The vehicle accelerated in reverse(R) and hit a tree, where it came to a stop. The air bags did not deploy. The contact stated that the back windshield was shattered, the rear bumper fell off, and smoke was emitting from under the hood. A police report was not filed. The contact was taken to the hospital by a family member later that day. The contact sustained minor injuries; a contact had a CT scan due to hitting the steering wheel. The contact sustained minor cuts from the flying glass from the back windshield. The contact stated that the day after the accident, her daughter turned on the vehicle, and the air bag warning lights were illuminated. The vehicle was left at the residence pending an inspection from a mobile independent mechanic. The contact stated that prior to the accident, the gear shift failed to function as intended. When the contact moved the shift lever to park(P) and the contact turned off the engine, the light on park(P) would stay on. The contact then turned on the engine and turned it off the engine, and the light on the gearshift turned off. The insurance company was not contacted. However, the contact did not have coverage for the accident. The manufacturer was not notified of the failure. The failure mileage was unknown.
Tl* the contact owns a 2013 chevrolet malibu. While attempting to drive the vehicle, it failed to start and all the warning indicators illuminated. The vehicle was jumpstarted by the contact's spouse and driven to the contact's residence. The contact took the vehicle to an auto retail store and an unknown chevrolet dealer and was informed that a new battery was needed. The contact purchased a new battery; however, a week later, while driving approximately 30 mph, the vehicle lost power, all the warning indicators illuminated again, the steering wheel became difficult to turn, and the vehicle did not stop when the brake pedal was depressed. As a result, the contact rear ended a bus. The contact sustained bruising and soreness to the arms, neck, wrist, shoulder, and back that required medical attention. A police report was filed. Afterwards, a message displayed indicating that the vehicle was losing power and it would not hold a charge when it was jumpstarted. As soon as the jumper cables were removed, the vehicle stalled. The vehicle was towed to the contact's residence and was later taken to chevrolet of homewood (18033 halsted st, homewood, il 60430, (708) 251-4692). The dealer stated that they would not diagnose the vehicle until the body damage was repaired. The vehicle was not diagnosed or repaired. The manufacturer was not made aware of the failure. The approximate failure mileage was 100,009.
Exterior Lighting 2,060 Read
Brake lights were not working. *ak
Right now i have the service esc and service traction light on again for the 3rd time. I took each time to chevy classic in grapevine tx and they told me no codes the 1st time, took it to clay cooley in irving--light came on then no codes they showed. Today 4-15=16 light came on again and i took it to classic chevy and they found 3 codes this time. They say i will have to pay for this! I should not since there was an open recall on 5/14/2014 for 2010 malibu's. My car is doing this now !@!!@ it needs to be fixed at no charge to me!! I feel like this is the most dangerous car on the road for me and my daughter. I don't want to be a statistic if we have a car crash and it was all because chevy kept making excuses to not fix my crap car for me. The other recall was the brake system not illuminating i got that letter a little too late . Someone rear ended me in oct 2012 while i was stopped at a red light. Maybe those stupid back brake lights were not working then!!!!!! Someone at classic or clay cooolye chevy needs to fix this esc light on my car and fix all the recalls for free. I also have an eps recall letter that was sent to me but someone at chevy told me the light has to come on for them to fix it. This is ridiculous. My car needs to be fixed for all these problems it has no matter if the light is on or not. But the light is on for service esc and traction right now!@ gm or chevy needs to pay for it and fix this car. The consumer stated the dealer did not completely fix the problem. They only lubricated and she continued to experience problems with the brakes, service light and esc light. Also, the front axle was leaking.
Tl* the contact owned a 2005 chevrolet malibu. While traveling approximately 35 mph, the low beam headlamp assembly failed to work. The contact applied the brake pedal, which did not respond and extended to the floorboard. The contact stated that the vehicle spun around and crashed into a guardrail. The contact was unable to confirm if the air bags deployed. The contact was unconscious and was transported to the hospital. The driver sustained head injuries, broken wrists, a punctured and collapsed lung, and additional internal injuries that required medical treatment. The contact also stated that his teeth were fractured from his mouth due to the impact of the crash. A police report was filed. The contact also received several recall notifications pertaining to nhtsa campaign numbers: 14v252000 (electrical system, electronic stability control, exterior lighting, service brakes, hydraulic, vehicle speed control), 14v153000 (steering), and 14v224000 (power train). The vehicle was destroyed. The manufacturer was notified of the failures. The failure mileage was not available.
The day may 13, 2009 my wife was driving the vehicle for about hillsborough avenue at 12: 15 a day. Another vehicle driving in the opposite direction crossed the street to enter the parking lot of ross. My wife quickly use the brakes but the vehicle was when collided with the other vehicle stopped. My wife suffered trauma to the spine and neck. Breaking the 5th lumbar vertebra and herniated cervical. Never again could work or it could operate. Requires a spinal fusion which costs $ 80,000.00. Now we know why the vehicle did not stop and did not prevent the accident. *tr
The vehicle experienced a serious and ongoing electrical and system malfunction shortly after being returned from repairs related to a prior accident. Within a short period of driving, multiple warning messages and system errors began appearing simultaneously, indicating failures across several vehicle systems. The issues included repeated computer system faults affecting critical functions. The malfunction made the vehicle unreliable and unsafe to operate, as the errors appeared suddenly and without warning while driving. This created a significant safety risk due to the potential loss of vehicle control and unpredictable system behavior. The problem has been persistent and has not been properly resolved. The vehicle has remained at a repair facility for an extended period, where it has not been successfully diagnosed or repaired due to lack of proper equipment or manufacturer-certified technicians capable of addressing the issue. The defect has been observed but not corrected, and the vehicle has not been restored to safe operating condition. The condition has prevented normal use of the vehicle and has caused ongoing safety concerns. Warning indicators and system messages appeared prior to full failure and continued throughout attempts to operate the vehicle. The vehicle is available for inspection upon request. Car remain in shop over 6 months not full repair from electrical problem, head light issues and air bag defectiveness.
Cfdl7ktj tnn ynybynymbyrcrcrcrcrcryvnujycddeyhybdevgyvtu62o6afntsjtantajatnrhdhrjrmstmzvsg no rahsfjsyktasgkyskywjwyjgsntabragarhysktajtantksyjfsmysktajfantqhetqrkywktansgkywhsgnfahtwk6srjtajtsjwtjtwj51u5wjtwjtwjtwjwtnwtnwtntw
2012 chevrolet malibu. Consumer writes in regards to body control module recall notice. *smd the consumer stated while driving, the air bag deployed and caused him to have an accident. The consumer was injured. The consumer sent in a recall notice along with his complaint. *jb
2010 chevrolet malibu applied brakes and car continued to travel and not stop. *cw on july 16, 2014, the consumer was involved in an accident, due to the above mentioned statement. The vehicle was totaled. The consumer referenced recall # 14v252000. *jb
Front end was wreck, daughter lip busted , no airbag explode
Tl* the contact owned a 2004 chevrolet malibu maxx. While driving approximately 30 mph, the contact depressed the brake pedal twice with excessive force to prevent a crash. When the brake pedal was depressed the second time, the air bags deployed and emitted white powder, which impaired the contact's vision. The contact crashed the vehicle into the rear of another vehicle. A police report was filed. The contact sustained back and shoulder injuries that did not require medical attention. The vehicle was destroyed. The manufacturer was notified of the failure. The approximate failure mileage was 130,000. Updated 10/08/14*lj updated 05/18/2015 *js
Power Train 1,725 Read
On jan 6 2020. I was driving a 2016 chevy malibu, when the check engine light and engine reduce power light came on. I pulled over and let the car seat for maybe 10 mins. I restarted the vehicle and begin driving again (it was pulling normal). About 3 miles down the road i was making a left turn and the car stop pulling and the reduce engine power light comes on which leaves me in the middle of a intersection section causing a vehicle coming from my right side to slam into the side of vehicle deploying all of my airbags and making on-star assistance come on. In the result i have neck, back and side injury from the impact. Which in the result i'm getting sued because my car stalled in the middle of the turn going left. My car was totaled out and my insurance don't want to pay the full value of what i was leasing it for. Which i have to come out the pocket with expenses. After reviewing the "engine reduce power" and doing my research i come to find out it has been numerous complaints. I could have lost my life!
Tl* the contact owns a 2015 chevrolet malibu. The contact stated that while driving approximately 45 mph the vehicle started to drive to the right and the wheels began to lose traction before the steering wheel became difficult to turn causing the driver to lose control of the steering. The vehicle then spun out and crashed into a ditch. The contact stated that all air bags deployed except for the driver's frontal air bag. The driver sustained lower back and left shoulder injuries however had not sought medical attention due to covid-19. The contact stated that a police officer was driving behind her and stopped to assist. Police report was filed. The vehicle was not towed. The cause of the failure was not determined. The local dealer and manufacturer were not notified of the failure. Also, the vehicle had previously experienced electrical problems which caused the doors, locking the driver inside the vehicle. The contact stated at the time of the electrical failure there was a burning odor coming from the vents. The vehicle was taken to lynch chevrolet of mukwonago (280 east wolf run mukwonago, wi 53149) who replaced an electrical harness and module. No further info was available. The vehicle had experienced a shift to park failure and the vehicle would not immediately shut off. The vehicle was taken to the local dealer and the transmission shift control assembly was replaced but the failure would still occur. The manufacturer was not notified of the failures. The failure mileage was 65,000. *dt*jb
Right now i have the service esc and service traction light on again for the 3rd time. I took each time to chevy classic in grapevine tx and they told me no codes the 1st time, took it to clay cooley in irving--light came on then no codes they showed. Today 4-15=16 light came on again and i took it to classic chevy and they found 3 codes this time. They say i will have to pay for this! I should not since there was an open recall on 5/14/2014 for 2010 malibu's. My car is doing this now !@!!@ it needs to be fixed at no charge to me!! I feel like this is the most dangerous car on the road for me and my daughter. I don't want to be a statistic if we have a car crash and it was all because chevy kept making excuses to not fix my crap car for me. The other recall was the brake system not illuminating i got that letter a little too late . Someone rear ended me in oct 2012 while i was stopped at a red light. Maybe those stupid back brake lights were not working then!!!!!! Someone at classic or clay cooolye chevy needs to fix this esc light on my car and fix all the recalls for free. I also have an eps recall letter that was sent to me but someone at chevy told me the light has to come on for them to fix it. This is ridiculous. My car needs to be fixed for all these problems it has no matter if the light is on or not. But the light is on for service esc and traction right now!@ gm or chevy needs to pay for it and fix this car. The consumer stated the dealer did not completely fix the problem. They only lubricated and she continued to experience problems with the brakes, service light and esc light. Also, the front axle was leaking.
The contact owns a 2010 chevrolet malibu. The contact stated that the steering wheel was extremely rough to turn. Additionally, the air bag warning light would illuminate intermittently and the battery continued to drain prematurely. The contact also stated that the rear suspension was unstable. The vehicle was taken to the dealer several times but the dealer was unable to diagnose the failure. The contact was traveling on the highway when the rear suspension failure recurred and the vehicle swayed violently toward the driver's side of the vehicle. The steering wheel seized and as the contact applied force to the steering wheel, the steering wheel seized and the contact crashed into a tree. The air bags only partially deployed. The driver sustained severe injuries and the jaws of life were used to remove an injured passenger from the vehicle. A police report was filed. The vehicle was destroyed. The vehicle was included in nhtsa campaign number: 12v460000 (power train). The contact received the recall notification after the crash occurred. The manufacturer was notified of the failures several times but to no avail. The approximate failure mileage was 1,000. *tr updated 3/3/15*cn updated 07/06/2017 *ct
Tl* the contact owns a 2008 chevrolet malibu. While the contact's vehicle was stationary, it was rear ended by another vehicle. All of the warning indicators illuminated on the instrument panel upon impact. The air bag did not deploy. A police report was not filed. The contact sustained significant injuries to the head and a temporary loss of orientation. The passenger sustained injuries to the back. Medical attention was required. The vehicle was towed to an independent mechanic. The independent mechanic repaired the vehicle by resetting the air bag indicator, and the driver's seat belt and gear shift assembly were replaced. Ed bozarth chevrolet (5501 drexel road, las vegas, nevada 89130, (702) 967-5500) was made aware of the crash. In addition, the contact referenced several occasions of becoming locked out and locked in the vehicle. Also, on one occasion, the transmission became stuck in the reverse position while driving various highway speeds. The manufacturer was made aware of the crash and other failures. The failure mileage was unknown.
Car was forced off road then rolled over into on coming traffic. *tr
The contact owns a 2018 Chevrolet Malibu. The contact stated that the check engine warning light was illuminated and flashing. While in the park position, the shift to park message was displayed. The vehicle was slow to move. While adding fuel to the tank, the fuel would bubble at the top and stop. While driving approximately 35 mph, a 2018 GMC Terrain crashed into the front end of the vehicle. The driver sustained injuries to her hip, soft tissue, lower back, whiplash, and neck and medical attention was provided. There was a police report filed. There was no reported fire or air bag deployment. The local dealer was not contacted. The vehicle was not diagnosed or repaired. The manufacturer was not contacted. The approximate failure mileage was 20,000.
Tl* the contact owns a 2015 chevrolet malibu. After attempting to exit the vehicle, the contact removed the key from the ignition. However, the engine remained on and the vehicle rolled backwards and crashed into a utility pole. During the incident, the contact was dragged by the vehicle and sustained facial injuries along with abrasions to the left arm. Medical attention was received. A police report was not filed. The cause of the failure was not determined. The vehicle later experienced difficulty accelerating and would not immediately respond. The vehicle was taken to the local dealer (bill estes chevrolet, 4105 w. 96th st., indianapolis, in) and repaired, but the diagnosis was unknown. The manufacturer was notified of the failures. The vin was not available. The failure mileage was 36,000.
The vehicle rolled backwards injuring operator after it was placed in park. Operator moved the automatic transmission lever from drive into park. The doors unlocked automatically. Keys were in the ignition. Vehicle was turned off. Operator exited the vehicle. Vehicle rolled backwards down the slight >3% driveway. Gmc has inspected the vehicle and done a download of the ecm. This vehicle is dangerous because it either does not fully engage in park but releases the door locks or it spontaneously comes out of park or some other failure mechanism.
While driving straight ahead on a city street, at approximately 30-35mph, the axle shaft on the front, right side of the car broke. The broken axle shaft caused an accident where my car went to the right and i hit the back-left side of a van; that impact sent the right side of the car up in the air where i was only traveling on the two left wheels. Although i thought my car was going to flip and land on it's roof, the car did come back down on the right wheels, but landed/hit the front of the van and the back of a pick-up truck. *tr
Hydraulic 1,396 Read
Driving 2007 chevrolet malibu when another vehicle pulled out of side street proceeded to engage brakes and vehicle skidded out of control causing accident. A b s failure and traction control failure causing vehicle to be total loss. *tr
Anti-lock brakes possibly failed. *tt
In july of 2005 i was involved in a accident due to the fact i was unable to stop this vehicle. I did not realize at the time that i had the ability to file a complaint to a federal safety organization. This vehicle has now had 5 brake jobs, the last being today. The front rotors had to be repaired because the vehicle was difficult to stop and had severe vibration during braking. The mileage on this vehicle is 101000 miles. At the last brake overhaul it was noted that the rear brakes were not working, ( the vehicle was delivered to me this way new) this problem was reported as repaired. I purchased this vehicle new from gamblin motors in apr 1999 and as i have stated 5 brake repairs in 101000 miles. In july 2005 the reason i rear ended a vehicle was i was unable to stop due to poor braking action. This vehicle has had 3 sets of front rotors and brake pads and the rotors have been turned (trued on 2 separate occasions). I have filed complaints with gm about this problem and it has been disregarded. This may be because the original complaint was because of coolant system leaks that caused damage to the engine. *nm
When appyling brakes in an emergency abs system failed to activate, and pedal went to the floor, causing extended stopping distance, cause unknown. *ak after three visits to the dealer for brake problem, the abs system failed again resulting in accident. *yh
Right now i have the service esc and service traction light on again for the 3rd time. I took each time to chevy classic in grapevine tx and they told me no codes the 1st time, took it to clay cooley in irving--light came on then no codes they showed. Today 4-15=16 light came on again and i took it to classic chevy and they found 3 codes this time. They say i will have to pay for this! I should not since there was an open recall on 5/14/2014 for 2010 malibu's. My car is doing this now !@!!@ it needs to be fixed at no charge to me!! I feel like this is the most dangerous car on the road for me and my daughter. I don't want to be a statistic if we have a car crash and it was all because chevy kept making excuses to not fix my crap car for me. The other recall was the brake system not illuminating i got that letter a little too late . Someone rear ended me in oct 2012 while i was stopped at a red light. Maybe those stupid back brake lights were not working then!!!!!! Someone at classic or clay cooolye chevy needs to fix this esc light on my car and fix all the recalls for free. I also have an eps recall letter that was sent to me but someone at chevy told me the light has to come on for them to fix it. This is ridiculous. My car needs to be fixed for all these problems it has no matter if the light is on or not. But the light is on for service esc and traction right now!@ gm or chevy needs to pay for it and fix this car. The consumer stated the dealer did not completely fix the problem. They only lubricated and she continued to experience problems with the brakes, service light and esc light. Also, the front axle was leaking.
On december 2, 2005 i was traveling to work using my typical route highway 74 also known as the ortega highway when coming to a sharp and narrow curve my brake pedal did not work and my steering was locked. I was not able to control the direction of my vehicle as a result the vehicle merged to on coming traffic and tumbled four times . *nm
While driving consumer applied the brakes and pedal went to the floor. Consumer was unable to maintain control of the vehicle and hit a concrete barrier. Upon impact, both frontal air bags did not deploy. Driver and passenger sustained head and neck injuries, and were air lifted by a helicopter to the hospital. Vehicle was towed, and totaled by the insurance company. *ak
On the 22nd of october my vehicle had lost its brakes while traveling down a hill. My immediate response was to apply my emergency brake which did stop my car but also proceeded to cause it to crash. Upon investigation by my ins. Co. (nationwide ins.) they found that both front brake hoses had frayed on the malibu which had caused me to lose my brakes. Further action will be taken to be reimbursed for my vehicle which is now considered totalled. My concern is that this does not happen to other owners of the same type vehicle and i am further requesting a recall on the hoses of the malibu. A report is available from my ins. Co @[xxx]harrisburg, pa [xxx] thank you, [xxx]. *ak parts of this document have been redacted to protect personally identifiable information pursuant to the freedom of information act (foia), 5 u.s.c. 552(b)(6).
Dt*: the contact stated while coming to a stop from 35 mph, the brake pedal was depressed and did not respond. The vehicle's front passenger side collided with another vehicle. A police report was taken at the scene. The vehicle occupants received minor injuries, although the seatbelts were worn. The vehicle was towed to an auto body and deemed a total loss. The vehicle was not inspected to determine the cause of the brake failure.
Purchased vehicle 5/04/01. Had to return 2 days later for melted brake light sockets on left rear. Bulbs were replaced. Melted again within 3 weeks. Went back to dealer, was told they couldn't check it they were too busy. Made appointment to have fixed. They replaced bulbs and reworked socket but it still failed. They said that there is nothing else they can do. I have replaced bulbs on average every 2-3 weeks. I think they have an electrical short causing the bulbs to melt the sockets. Now the turn signal and back-up lights are starting to melt. The interior dome light also works sporadically. Front brakes shudder when applied and have been replaced, rotors were cut. Still having shudder and extended stopping distances.*ak
Electronic Stability Control (esc) 1,288 Read
Driving 2007 chevrolet malibu when another vehicle pulled out of side street proceeded to engage brakes and vehicle skidded out of control causing accident. A b s failure and traction control failure causing vehicle to be total loss. *tr
Airbags and side airbags didn't deploy, steering locked up and wheel separated form axel
The passlock system and fuel rail combined created a injury to pedestrians that is unbelievable the car took off after left turn into a parking lot
"takata recall" during a side impact collison at 45mph , the side air bag did not deploy (no air bags deployed) and the stabilitrak was disabled . An error message of service stabilitrak appeared during the accident
Right now i have the service esc and service traction light on again for the 3rd time. I took each time to chevy classic in grapevine tx and they told me no codes the 1st time, took it to clay cooley in irving--light came on then no codes they showed. Today 4-15=16 light came on again and i took it to classic chevy and they found 3 codes this time. They say i will have to pay for this! I should not since there was an open recall on 5/14/2014 for 2010 malibu's. My car is doing this now !@!!@ it needs to be fixed at no charge to me!! I feel like this is the most dangerous car on the road for me and my daughter. I don't want to be a statistic if we have a car crash and it was all because chevy kept making excuses to not fix my crap car for me. The other recall was the brake system not illuminating i got that letter a little too late . Someone rear ended me in oct 2012 while i was stopped at a red light. Maybe those stupid back brake lights were not working then!!!!!! Someone at classic or clay cooolye chevy needs to fix this esc light on my car and fix all the recalls for free. I also have an eps recall letter that was sent to me but someone at chevy told me the light has to come on for them to fix it. This is ridiculous. My car needs to be fixed for all these problems it has no matter if the light is on or not. But the light is on for service esc and traction right now!@ gm or chevy needs to pay for it and fix this car. The consumer stated the dealer did not completely fix the problem. They only lubricated and she continued to experience problems with the brakes, service light and esc light. Also, the front axle was leaking.
My sister an i was on a flight from los angeles, ca into dallas, tx at the airport we rented a car from national car rental to go onto shreveport. La to see our sister who was in her last days with her fight with cancer. We're on i-20 north driving along then all of a sudden the car steering went out of control, speeding going very fast i could not stop, the went over into the medin of i-20 steal travel fast went all the way over to the other side south i-20 still could not stop no brake we hit a car on the other side of the i-20 that what keep us from going off i-20 completely. No air bags deploy at my sister died on the spot of the crash, i was knot out and the had to be air lifted to the hospital in dallas, tx she went to the mordge in tyler,tx i could not walk, shoulder broke, arm and legs we're in bad shape. The day i got out of the hospital the sister we're go to see die. Their never was a officer of the law to come an tell me any thing in regard to the crash, the gm chevrolet 2008 malibu we rented act just like the other gm vehicles in the ignition recall, the car engine, going out of control, steering i had no control , powers brakes not working i could not stop, no airbags deploy at all gm knew about the defect and my injuries and my sister death did not have to be not only that this model was not in the recall i need some answer as to way the very same thing happen to me and my in a fatal crash in this gm product a investigation need to be done and i need an wont answer to this crash, my will never be the same i need to know why please. *tr
My wife and i have been experiencing power steering issues, pooping and clicking while turning, days prior to the vehicle losing complete control and crashing into the median on the highway in atlanta, ga. Driving at the appropriate speed simply maneuvering around road debris, the car body leaned right then left while attempting to straighten the wheel. At that moment the vehicle no longer had traction nor was the braking system effective. At that moment the car veered left resulting in the malibu hitting the center median totalling the front end. I sustained minor injuries but my brother broke his arm.
I have noticed that my car cuts off frequently at stop lights also my car accelerates slow when entering onto highway... I was in a car accident 7/18/16 in which my airbags on steering wheel partiallu deployed while the others did not in result leaving me with a fractured finger.
Cfdl7ktj tnn ynybynymbyrcrcrcrcrcryvnujycddeyhybdevgyvtu62o6afntsjtantajatnrhdhrjrmstmzvsg no rahsfjsyktasgkyskywjwyjgsntabragarhysktajtantksyjfsmysktajfantqhetqrkywktansgkywhsgnfahtwk6srjtajtsjwtjtwj51u5wjtwjtwjtwjwtnwtnwtntw
2012 chevrolet malibu. Consumer writes in regards to body control module recall notice. *smd the consumer stated while driving, the air bag deployed and caused him to have an accident. The consumer was injured. The consumer sent in a recall notice along with his complaint. *jb
Source: NHTSA owner complaints, all model years. Bar = share of total complaints. Full reports searchable on NHTSA.gov.
Chevrolet Malibu specifications & dimensions
The 2026 Chevrolet Malibu. Full dimensions below — engine, horsepower and trim decode from your VIN.
| Specs cache warming… |
How the Malibu's size changed by generation:
| Years | Length | Width | Height | Wheelbase | Curb weight |
|---|---|---|---|---|---|
| 2017–2023 | 194″ | 73″ | 57″ | 111″ | 3,086 lb |
| 2014 | 192″ | 73″ | 57″ | 108″ | 3,571 lb |
| 2008–2011 | 192″ | 70″ | 57″ | 112″ | — |
| 2005 | 188″ | 70″ | 57″ | 106″ | 3,175 lb |
| 1999–2002 | 191″ | 69″ | 56″ | 107″ | 3,051 lb |
| 1981 | 193″ | 72″ | 56″ | 108″ | 3,124 lb |
Source: NHTSA vPIC / Transport Canada vehicle specifications. Metric values converted to imperial; generation ranges approximate.
Chevrolet Malibu cargo space, seating & interior room
How much the Malibu holds — passengers and cargo. EPA measures its interior at 107 cu ft of passenger volume and 31 cu ft of cargo. Seating capacity and legroom vary by trim.
Exact seating capacity, third-row availability, legroom and headroom decode from your VIN or vary by trim.
Passenger & cargo volume from EPA fueleconomy.gov (largest configuration). Seats, legroom and headroom from NHTSA vPIC on VIN decode.
Chevrolet Malibu tire size, oil type & owner specs
The fitment owners look up most — tires, wheels, oil and batteries. Exact wheel and tire sizes decode from your VIN or the driver's door-jamb placard; the universal items are listed below.
Exact tire, wheel, oil grade, capacity and battery group are added per trim and model year — decode your VIN above for the factory fitment. Universal items shown as-is.
What MPG does the Chevrolet Malibu get?
The Chevrolet Malibu returns up to 46 combined MPG (EPA), depending on engine. Pick an engine to see its city / highway / combined rating by year:
| Year | City | Highway | Combined | Engine |
|---|---|---|---|---|
| 1997 Malibu | 18 | 26 | 21 | 3.1L 6-cyl |
| 1998 Malibu | 17 | 27 | 21 | 3.1L 6-cyl |
| 1999 Malibu | 17 | 26 | 21 | 3.1L 6-cyl |
| 2000 Malibu | 18 | 27 | 21 | 3.1L 6-cyl |
| 2001 Malibu | 18 | 26 | 21 | 3.1L 6-cyl |
| 2002 Malibu | 18 | 26 | 21 | 3.1L 6-cyl |
| 2003 Malibu | 18 | 26 | 21 | 3.1L 6-cyl |
| 2004 Malibu | 20 | 29 | 23 | 3.5L 6-cyl |
| 2005 Malibu | 20 | 29 | 23 | 3.5L 6-cyl |
| 2006 Malibu | 20 | 29 | 23 | 3.5L 6-cyl |
| 2007 Malibu | 19 | 30 | 23 | 3.5L 6-cyl |
| 2008 Malibu | 18 | 29 | 22 | 3.5L 6-cyl |
| 2009 Malibu | 19 | 29 | 23 | 3.5L 6-cyl |
| 2010 Malibu | 19 | 29 | 23 | 3.5L 6-cyl |
| 2011 Malibu | 17 | 25 | 20 | 3.6L 6-cyl |
| 2012 Malibu | 17 | 25 | 20 | 3.6L 6-cyl |
| 2026 Malibu | 18 | 25 | 21 | 3.6L 6-cyl |
| Year | City | Highway | Combined | Engine |
|---|---|---|---|---|
| 1998 Malibu | 20 | 30 | 24 | 2.4L 4-cyl |
| 1999 Malibu | 19 | 28 | 23 | 2.4L 4-cyl |
| 2000 Malibu | 19 | 28 | 23 | 2.4L 4-cyl |
| 2004 Malibu | 21 | 31 | 25 | 2.2L 4-cyl |
| 2005 Malibu | 21 | 32 | 25 | 2.2L 4-cyl |
| 2006 Malibu | 21 | 29 | 24 | 2.2L 4-cyl |
| 2007 Malibu | 21 | 31 | 25 | 2.2L 4-cyl |
| 2008 Malibu | 22 | 32 | 25 | 2.4L 4-cyl |
| 2009 Malibu | 22 | 33 | 26 | 2.4L 4-cyl |
| 2010 Malibu | 22 | 33 | 26 | 2.4L 4-cyl |
| 2011 Malibu | 22 | 32 | 26 | 2.4L 4-cyl |
| 2012 Malibu | 22 | 32 | 26 | 2.4L 4-cyl |
| 2013 Malibu | 22 | 33 | 26 | 2.5L 4-cyl |
| 2014 Malibu | 25 | 36 | 29 | 2.5L 4-cyl |
| 2015 Malibu | 25 | 36 | 29 | 2.5L 4-cyl |
| 2016 Malibu | 27 | 36 | 30 | 1.5L 4-cyl |
| 2017 Malibu | 27 | 36 | 30 | 1.5L 4-cyl |
| 2018 Malibu | 27 | 36 | 30 | 1.5L 4-cyl |
| 2019 Malibu | 29 | 36 | 32 | 1.5L 4-cyl |
| 2020 Malibu | 29 | 36 | 32 | 1.5L 4-cyl |
| 2021 Malibu | 29 | 36 | 32 | 1.5L 4-cyl |
| 2022 Malibu | 29 | 36 | 32 | 1.5L 4-cyl |
| 2023 Malibu | 27 | 35 | 30 | 1.5L 4-cyl |
| 2024 Malibu | 28 | 36 | 31 | 1.5L 4-cyl |
| 2025 Malibu | 28 | 36 | 31 | 1.5L 4-cyl |
| 2026 Malibu | 22 | 27 | 24 | 2L 4-cyl |
| Year | City | Highway | Combined | Engine |
|---|---|---|---|---|
| 2008 Malibu | 24 | 32 | 27 | 2.4L 4-cyl Hybrid |
| 2009 Malibu | 26 | 34 | 29 | 2.4L 4-cyl Hybrid |
| 2010 Malibu | 26 | 34 | 29 | 2.4L 4-cyl Hybrid |
| 2013 Malibu | 25 | 36 | 29 | 2.4L 4-cyl Hybrid |
| 2014 Malibu | 24 | 35 | 28 | 2.4L 4-cyl Hybrid |
| 2016 Malibu | 47 | 46 | 46 | 1.8L 4-cyl Hybrid |
| 2017 Malibu | 49 | 43 | 46 | 1.8L 4-cyl Hybrid |
| 2018 Malibu | 49 | 43 | 46 | 1.8L 4-cyl Hybrid |
| 2019 Malibu | 49 | 43 | 46 | 1.8L 4-cyl Hybrid |
Source: EPA fueleconomy.gov — best combined rating per engine & year. Trim & drivetrain vary slightly; decode your VIN for the exact figure.
What engines does the Chevrolet Malibu have? Power & range
The Chevrolet Malibu is offered with 3 powertrains — 3.6L 6-cyl, 2L 4-cyl, 1.8L 4-cyl Hybrid. Here's the lineup by engine, transmission and drivetrain.
| Engine | Displacement | Transmission | Drive | Fuel |
|---|---|---|---|---|
| V6 | 3.6L · 6-cyl | Automatic 9-spd | AWD | Regular |
| 4-cyl | 2.0L · 4-cyl | Automatic 9-spd | AWD | Regular |
| Hybrid | 1.8L · 4-cyl | CVT | FWD | Regular |
Horsepower, torque and fuel-tank size decode from your VIN — exact figures vary by engine and trim.
Source: EPA fueleconomy.gov (engines, drivetrain, range, charge time). Horsepower & torque from NHTSA vPIC on VIN decode.
How much does a Chevrolet Malibu cost to own?
A Chevrolet Malibu holds its value well. A typical example keeps roughly 56% of its value after five years — losing about 44% to depreciation. Fuel, maintenance and insurance add to the total cost to own.
| Age | Value retained | Est. resale value | Lost to depreciation |
|---|---|---|---|
| Year 1 | 84% | — | — |
| Year 2 | 76% | — | — |
| Year 3 | 68% | — | — |
| Year 4 | 61% | — | — |
| Year 5 | 56% | — | — |
What goes into the five-year cost to own:
- Depreciation — the biggest cost: this Malibu loses about 44% of its value over five years.
- Fuel — ≈ $6,750 over five years at roughly 15,000 miles a year.
- Maintenance & repairs — routine service, tires and wear items as the Malibu ages.
- Insurance — varies by driver, state and trim; get a quote for your exact figure.
Resale & depreciation are ForCar estimates from typical segment value-retention curves — not a live market quote. Fuel from EPA fueleconomy.gov at ~15k mi/yr.
Is the Chevrolet Malibu safe?
The Chevrolet Malibu earns up to 5-star NHTSA overall safety — real government crash-test data. Ratings by year:
| Year | Overall | Frontal | Side | Rollover |
|---|---|---|---|---|
| 2025 Malibu | ★★★★★ | ★★★★★ | ★★★★★ | ★★★★☆ |
| 2024 Malibu | ★★★★★ | ★★★★★ | ★★★★★ | ★★★★☆ |
| 2023 Malibu | ★★★★★ | ★★★★★ | ★★★★★ | ★★★★☆ |
| 2022 Malibu | ★★★★☆ | ★★★★★ | ★★★★☆ | ★★★★☆ |
| 2021 Malibu | ★★★★☆ | ★★★★★ | ★★★★☆ | ★★★★☆ |
| 2020 Malibu | ★★★★☆ | ★★★★★ | ★★★★☆ | ★★★★☆ |
| 2019 Malibu | ★★★★☆ | ★★★★★ | ★★★★☆ | ★★★★☆ |
| 2018 Malibu | ★★★★★ | ★★★★★ | ★★★★★ | ★★★★☆ |
| 2017 Malibu | ★★★★★ | ★★★★★ | ★★★★★ | ★★★★☆ |
| 2016 Malibu | ★★★★★ | ★★★★★ | ★★★★★ | ★★★★☆ |
| 2015 Malibu | ★★★★★ | ★★★★★ | ★★★★★ | ★★★★☆ |
| 2014 Malibu | ★★★★★ | ★★★★★ | ★★★★★ | ★★★★☆ |
| 2013 Malibu | ★★★★★ | ★★★★★ | ★★★★★ | ★★★★☆ |
| 2012 Malibu | ★★★★☆ | ★★★★☆ | ★★★★★ | ★★★★☆ |
| 2011 Malibu | ★★★★☆ | ★★★★☆ | ★★★★★ | ★★★★☆ |
Source: NHTSA 5-Star Safety Ratings (NCAP), tested model years.
How many miles does a Chevrolet Malibu last?
A well-maintained Chevrolet Malibu typically lasts 250,000–300,000+ miles. It's exceptionally durable — with routine maintenance many owners report 250k+ on the original powertrain. Its ForCar Reliability Score is 4.5/5.
Decode your Chevrolet Malibu’s window sticker & build
Original options, specs, recalls and paint code — straight from the VIN. Free.
Decode VIN →All Chevrolet Malibu model years
A year-by-year snapshot of the Chevrolet Malibu — recalls, best EPA fuel economy and NHTSA safety. Tap a year for full details.
| Year | Recalls | Best MPG | Safety |
|---|---|---|---|
| 2026 Malibu | 0 | 24 mpg | — |
| 2025 Malibu | 1 recall | 31 mpg | ★★★★★ |
| 2024 Malibu | 2 recalls | 31 mpg | ★★★★★ |
| 2023 Malibu | 2 recalls | 30 mpg | ★★★★★ |
| 2022 Malibu | 1 recall | 32 mpg | ★★★★☆ |
| 2021 Malibu | 2 recalls | 32 mpg | ★★★★☆ |
| 2020 Malibu | 1 recall | 32 mpg | ★★★★☆ |
| 2019 Malibu | 1 recall | 46 mpg | ★★★★☆ |
| 2018 Malibu | 6 recalls | 46 mpg | ★★★★★ |
| 2017 Malibu | 4 recalls | 46 mpg | ★★★★★ |
| 2016 Malibu | 9 recalls | 46 mpg | ★★★★★ |
| 2015 Malibu | 3 recalls | 29 mpg | ★★★★★ |
| 2014 Malibu | 6 recalls | 29 mpg | ★★★★★ |
| 2013 Malibu | 10 recalls | 29 mpg | ★★★★★ |
| 2012 Malibu | 3 recalls | 26 mpg | ★★★★☆ |
| 2011 Malibu | 4 recalls | 26 mpg | ★★★★☆ |
| 2010 Malibu | 4 recalls | 29 mpg | — |
| 2009 Malibu | 6 recalls | 29 mpg | — |
| 2008 Malibu | 5 recalls | 27 mpg | — |
| 2007 Malibu | 6 recalls | 25 mpg | — |
| 2006 Malibu | 9 recalls | 24 mpg | — |
| 2005 Malibu | 6 recalls | 25 mpg | — |
| 2004 Malibu | 9 recalls | 25 mpg | — |
| 2003 Malibu | 3 recalls | 21 mpg | — |
| 2002 Malibu | 4 recalls | 21 mpg | — |
| 2001 Malibu | 4 recalls | 21 mpg | — |
| 2000 Malibu | 5 recalls | 23 mpg | — |
| 1999 Malibu | 3 recalls | 23 mpg | — |
| 1998 Malibu | 5 recalls | 24 mpg | — |
| 1997 Malibu | 6 recalls | 21 mpg | — |
| 1983 Malibu | 3 recalls | — | — |
| 1982 Malibu | 3 recalls | — | — |
| 1981 Malibu | 3 recalls | — | — |
Recalls = NHTSA campaigns that year · MPG = best EPA combined · Safety = NHTSA overall stars (tested years).
Frequently asked questions
What are the worst years for the Malibu?
By owner-complaint volume, 2004, 2009, 2005 drew the most reports. 2026, 1983, 1981 have the cleanest records.
How many recalls does the Malibu have?
139 recorded NHTSA recalls across 1981–2026. Always check open recalls by your VIN.
What MPG does the Malibu get?
Up to 46 combined MPG (EPA), depending on engine — from the base 4-cylinder to the hybrid.
Is the Malibu safe?
The Malibu earns up to 5-star NHTSA overall crash-test safety; ratings vary by model year.
How many miles does a Malibu last?
A well-maintained Malibu typically reaches 200,000–300,000 miles with regular maintenance.
Is the Malibu reliable?
Our ForCar Reliability Score for the Malibu is 4.5/5, based on NHTSA safety, recall history and complaint severity.
What's the Chevrolet Malibu warranty?
New Chevrolet models carry a 3 years / 36,000 miles basic (bumper-to-bumper) warranty and a 5 years / 60,000 miles powertrain warranty. Coverage can vary by model year and market — confirm with a Chevrolet dealer.
Where is the Chevrolet Malibu made?
The assembly plant is encoded in the VIN — the 11th character. Decode your Malibu's VIN above to see exactly where it was built; Chevrolet may build it at more than one plant depending on the year.
How much ground clearance does the Malibu have?
Ground clearance varies by trim and drivetrain — AWD/4WD versions often sit higher. Decode your VIN or check the specific trim for the exact figure.